Research Peptides

Press Enter to search the full catalog.

Lyophilized in the USA Peptides
US Domestic discreet shipping
High Purity Research Peptides
Third-party batch tested
HPLC & MS verified purity
Peptides Calculator
Lyophilized in the USA Peptides
US Domestic discreet shipping
High Purity Research Peptides
Third-party batch tested
HPLC & MS verified purity
Peptides Calculator
Back to all products
TB-500 2 mg

Peptide Sciences USA

TB-500 2 mg

Injection · 2 mg · vial

Out of stock
  • Active Substance: Thymosin Beta-4 (TB-500)
  • Concentration: 2 mg per vial
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: TB-500
  • Categories: Injectable Peptides, Healing & Recovery Peptides, Muscle Growth Peptides, Immune & Longevity Support Peptides
  • Molecular Formula: C212H350N56O78S
  • Molecular Weight: 4963.49 g/mol
  • Sequence: SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
  • Synonyms: Thymosin Beta-4, TB500
TB-500 2 mg
Order Now, Ships Today
Research Use Only

All products are intended solely for laboratory research and are not for human or animal consumption. By purchasing, the buyer agrees to use these products in compliance with all applicable laws.

TB-500 (Thymosin Beta-4) is a synthetic version of a naturally occurring peptide involved in tissue regeneration, cell migration, and angiogenesis. Supplied in a 2 mg injectable format by Peptide Sciences USA, TB-500 is widely studied for its potential to accelerate healing in soft tissue, tendons, ligaments, and muscle. Its ability to promote recovery and reduce inflammation makes it a cornerstone of regenerative and sports injury research.

Mechanism of Action

Thymosin Beta-4, the active substance in TB-500, plays a critical role in cell migration, wound repair, and cytoskeleton organization. It binds to actin monomers, regulating their polymerization and enabling cells to move and proliferate more efficiently. This is essential in repairing injured tissues and forming new blood vessels (angiogenesis).

TB-500 is thought to redistribute actin across injured regions, promoting tissue remodeling and accelerating regeneration. It also supports the formation of new capillaries, which enhance oxygen and nutrient delivery to damaged tissues. Additionally, TB-500 exhibits anti-inflammatory properties by reducing cytokine activity, contributing to pain relief and swelling reduction in injured areas.

Due to its broad cellular activity, TB-500 is explored across various research applications, including post-surgical recovery, soft tissue injuries, cardiac damage, and inflammation-driven disorders.

Key Features & Benefits

  • Accelerated Tissue Healing: Promotes regeneration of muscles, tendons, ligaments, and skin tissue in research models.
  • Supports Cell Migration: Facilitates actin polymerization and movement of cells to the site of injury.
  • Anti-Inflammatory Effects: Reduces cytokine activity and inflammation markers in injury and post-surgical settings.
  • Angiogenesis Promotion: Encourages formation of new blood vessels for enhanced tissue oxygenation.
  • Versatile Research Uses: Studied in wound healing, muscle recovery, and chronic tissue degeneration protocols.
  • High Purity Injectable: Provided as a 2 mg research-grade vial by Peptide Sciences USA for controlled scientific applications.

Frequently Asked Questions

1. What is TB-500 peptide?
TB-500 is a synthetic version of Thymosin Beta-4, studied for its role in healing muscle, tendon, and tissue damage through enhanced cell migration and anti-inflammatory activity.
2. What is TB-500 used for?
It is researched in contexts involving tissue repair, post-surgical recovery, injury healing, and inflammation reduction in soft tissue models.
3. Is TB-500 a steroid?
No. TB-500 is not a steroid. It is a peptide that mimics a naturally occurring protein involved in cellular healing and regeneration processes.
4. What does TB-500 peptide do?
TB-500 promotes tissue repair by improving cell movement, boosting blood vessel formation, and reducing inflammation at injury sites in scientific research settings.

No reviews yet

Be the first to share your experience with TB-500 2 mg

Log in to write a review

Complete the protocol

Stack it with

View all →
Added to cart