Peptides by Brands

Explore peptides from the most trusted brands in the industry. At BuyPeptides.net, we highlight top manufacturers like Peptide Sciences, Deus Medical, and Beligas—each selected for their lab-tested purity and performance. Whether you're searching for high-end peptides or cost-effective generics, you'll find the perfect option here.
Start shopping today and elevate your research with proven peptide brands.

Showing 50 of 173 products
Image
SKU
Product
Rating
Price
Only 23 hours left with this price
-30% OFF
Generic Peptides
  • Active Substance: 5-Amino-1-methylquinolinium
  • Concentration: 10 mg
  • Pack Size: vial
  • Manufacturer: Generic Peptides
  • Brand Name: 5-Amino 1MQ
  • Molecular Formula: C10H11N2+
  • Molecular Weight: 159.21 g/mol
  • Synonyms: 5-Amino-1-methylquinolinium, NNMT Inhibitor
Best Seller
Only 23 hours left with this price
-30% OFF
Generic Peptides
  • Active Substance: Nicotinamide Adenine Dinucleotide (NAD+)
  • Concentration: 250 mg per vial
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Generic Peptides
  • Brand Name: NAD
  • Molecular Formula: C21H27N7O14P2
  • Molecular Weight: 663.43 g/mol
  • Sequence: N/A (coenzyme)
  • Synonyms: Nicotinamide Adenine Dinucleotide, beta-NAD, Endopride
Dragon Pharma

  • Active Substance: Anti-Obesity Drug-9604 (AOD 9604)
  • Concentration: 5 mg per vial
  • Pack Size: Lyophilized vial for injection-based research
  • Manufacturer: Dragon Pharma
  • Brand Name: AOD9604
  • Molecular Formula: C78H123N23O23S
  • Molecular Weight: 1815.1 g/mol
  • Sequence: Tyr-Leu-Arg-Ile-Val-Gln-Cys-Arg-Ser-Val-Glu-Gly-Ser-Cys-Gly-Phe
  • Synonyms: hGH 176–191 fragment, Fat Loss Peptide, Lipolytic GH Fragment
Dragon Pharma
  • Active Substance: BPC-157 Pentadecapeptide
  • Concentration: 2 mg per vial
  • Pack Size: 1 vial (lyophilized powder)
  • Manufacturer: Dragon Pharma
  • Brand Name: BPC 157
  • Molecular Formula: C62H98N16O22
  • Molecular Weight: 1419.55 g/mol
  • Sequence: Gly-Glu-Pro-Pro-Pro-Gly-Lys-Pro-Ala-Asp-Asp-Ala-Gly-Leu-Val
  • Synonyms: Body Protection Compound-157, PL 14736
Dragon Pharma
  • Active Substance: Thymosin Beta 4 (TB-500) + BPC-157 Pentadecapeptide
  • Concentration: 5 mg TB-500 + 5 mg BPC-157 per vial
  • Pack Size: 1 vial (lyophilized blend for reconstitution)
  • Manufacturer: Dragon Pharma
  • Brand Name: Peptide Blend
  • Synonyms: BPC-TB Blend, Thymosin Beta-4 + BPC Research Formula, Regenerative Peptide Combo
Dragon Pharma
  • Active Substance: Cagrilintide
  • Concentration: 10 mg/ml per vial
  • Pack Size: Lyophilized injectable vial
  • Manufacturer: Dragon Pharma
  • Brand Name: Cagrilintide
  • Molecular Formula: C135H224N42O40S
  • Molecular Weight: ~3400 g/mol
  • Synonyms: AM833, Amylin Receptor Agonist, Long-Acting Amylin Analog
Dragon Pharma
  • Active Substance: Tetrasubstituted 30-Amino Acid Peptide Hormone (CJC-1295 DAC)
  • Concentration: 5 mg/ml per vial
  • Pack Size: 1 vial (lyophilized powder for reconstitution)
  • Manufacturer: Dragon Pharma
  • Brand Name: CJC-1295
  • Molecular Formula: C165H271N47O46
  • Molecular Weight: ~3649.30 g/mol
  • Synonyms: CJC-1295 with DAC, Drug Affinity Complex Peptide, GH Secretagogue
Dragon Pharma
  • Active Substance: Recombinant Human Growth Hormone (Somatropin)
  • Concentration: 100 IU per kit (multiple vials)
  • Pack Size: Full injectable peptide kit (lyophilized vials)
  • Manufacturer: Dragon Pharma
  • Brand Name: Dragontropin
  • Molecular Formula: C990H1528N262O300S7
  • Molecular Weight: ~22,125 Da
  • Sequence: 191-amino acid polypeptide identical to endogenous human GH
  • Synonyms: HGH, Somatropin, Recombinant GH, Human Growth Hormone
Dragon Pharma

  • Active Substance: Epitalon
  • Concentration: 50 mg per vial
  • Pack Size: 1 vial (lyophilized powder for research reconstitution)
  • Manufacturer: Dragon Pharma
  • Brand Name: Epitalon
  • Molecular Formula: C14H22N4O9
  • Molecular Weight: 390.35 g/mol
  • Sequence: Ala-Glu-Asp-Gly
  • Synonyms: Epithalon, Epithalamin, Pineal Peptide, Anti-Aging Peptide
Dragon Pharma
  • Active Substance: GW 501516 (Cardarine)
  • Concentration: 20 mg per tablet
  • Pack Size: 100 tablets
  • Manufacturer: Dragon Pharma
  • Brand Name: Cardarine
  • Molecular Formula: C21H18F3NO3S2
  • Molecular Weight: 453.5 g/mol
  • Synonyms: Cardarine, GW1516, Endurobol
Dragon Pharma
  • Active Substance: Human Chorionic Gonadotropin (HCG)
  • Concentration: 5000 IU per kit
  • Pack Size: Lyophilized vial + sterile diluent
  • Manufacturer: Dragon Pharma
  • Brand Name: Pregnyl
  • Molecular Formula: C1107H1770N318O336S26
  • Molecular Weight: ~36,700 Da
  • Synonyms: hCG, Chorionic Gonadotropin, Human LH analog
Dragon Pharma
  • Active Substance: Hexarelin
  • Concentration: 5 mg per vial
  • Pack Size: Lyophilized injectable vial
  • Manufacturer: Dragon Pharma
  • Brand Name: Hexarelin
  • Molecular Formula: C47H58N12O6
  • Molecular Weight: 887.04 g/mol
  • Synonyms: Examorelin, Hexarelin Acetate, Growth Hormone-Releasing Peptide-6 analog
Dragon Pharma
  • Active Substance: Insulin-like Growth Factor 1, Long R3 (IGF-1 LR3)
  • Concentration: 1 mg per vial
  • Pack Size: Lyophilized injectable vial
  • Manufacturer: Dragon Pharma
  • Brand Name: IGF-1 LR3
  • Molecular Formula: C400H625N111O115S6
  • Molecular Weight: ~9111 Da
  • Synonyms: Long R3 IGF-1, LR3 IGF-1, IGF1 analogue
Dragon Pharma
  • Active Substance: Ipamorelin
  • Concentration: 5 mg per vial
  • Pack Size: Lyophilized injectable vial
  • Manufacturer: Dragon Pharma
  • Brand Name: Ipamorelin
  • Molecular Formula: C38H49N9O5
  • Molecular Weight: 711.85 g/mol
  • Synonyms: IPAM, Growth Hormone Releasing Peptide-5, GHRP-5
Dragon Pharma
  • Active Substance: L-Carnitine
  • Concentration: 500 mg/ml
  • Pack Size: 1 x vial (injectable solution)
  • Manufacturer: Dragon Pharma
  • Brand Name: L-Carnitine
  • Molecular Formula: C7H15NO3
  • Molecular Weight: 161.2 g/mol
  • Synonyms: Levocarnitine, L-3-hydroxy-4-N-trimethylaminobutyric acid
Dragon Pharma
  • Active Substance: Ligandrol (LGD 4033)
  • Concentration: 15 mg per tablet
  • Pack Size: 100 tablets per bottle
  • Manufacturer: Dragon Pharma
  • Brand Name: Ligandrol
  • Molecular Formula: C14H12F6N2O
  • Molecular Weight: 338.25 g/mol
  • Synonyms: LGD-4033, VK5211, Ligandrol
Dragon Pharma
  • Active Substance: Mazdutide
  • Concentration: 10 mg/ml
  • Pack Size: 1 x vial (injectable solution)
  • Manufacturer: Dragon Pharma
  • Brand Name: Mazdutide
  • Molecular Formula: C219H358N64O68
  • Molecular Weight: Approx. 5100 g/mol
  • Synonyms: Oxyntomodulin analog, GLP-1/GCGR dual agonist
Dragon Pharma
  • Active Substance: Melanotan II Peptide Hormone
  • Concentration: 10 mg per vial
  • Pack Size: 1 x vial (lyophilized powder)
  • Manufacturer: Dragon Pharma
  • Brand Name: Melanotan
  • Molecular Formula: C50H69N15O9
  • Molecular Weight: 1024.2 g/mol
  • Synonyms: MT-II, MT2, Melanotan 2
Dragon Pharma
  • Active Substance: Enobosarm (MK-2866, Ostarine)
  • Concentration: 25 mg per tablet
  • Pack Size: 100 tablets per bottle
  • Manufacturer: Dragon Pharma
  • Molecular Formula: C19H14F3N3O3
  • Molecular Weight: 389.33 g/mol
  • Synonyms: MK-2866, Enobosarm, GTx-024
Dragon Pharma
  • Active Substance: Ibutamoren (MK-677)
  • Concentration: 25 mg per tablet
  • Pack Size: 100 tablets per bottle
  • Manufacturer: Dragon Pharma
  • Brand Name: Ibutamoren
  • Molecular Formula: C27H36N4O5S
  • Molecular Weight: 528.66 g/mol
  • Synonyms: MK-677, Ibutamoren mesylate, Nutrobal
Dragon Pharma
  • Active Substance: MOTS-c
  • Concentration: 10 mg per vial
  • Pack Size: 1 vial (lyophilized powder)
  • Manufacturer: Dragon Pharma
  • Brand Name: MOTS-c
  • Molecular Formula: C49H75N15O10
  • Molecular Weight: 1020.21 g/mol
  • Synonyms: Mitochondrial Open Reading Frame of the 12S rRNA-c, MDP-1
Dragon Pharma
  • Active Substance: Bremelanotide (PT-141)
  • Concentration: 10 mg per vial
  • Pack Size: 1 vial (lyophilized powder)
  • Manufacturer: Dragon Pharma
  • Brand Name: PT-141
  • Molecular Formula: C50H68N14O10
  • Molecular Weight: 1025.2 g/mol
  • Synonyms: PT-141, Bremelanotide Acetate
Dragon Pharma
  • Active Substance: Raloxifene Hydrochloride
  • Concentration: 60 mg per tablet
  • Pack Size: 100 tablets per bottle
  • Manufacturer: Dragon Pharma
  • Brand Name: Evista
  • Molecular Formula: C28H27NO4S•HCl
  • Molecular Weight: 510.04 g/mol
  • Synonyms: Evista, Raloxifene HCl, SERM-60
Dragon Pharma
  • Active Substance: Selank Anxiolytic Peptide
  • Concentration: 10 mg per vial
  • Pack Size: 1 vial (lyophilized powder)
  • Manufacturer: Dragon Pharma
  • Brand Name: Selank
  • Molecular Formula: C33H57N11O9
  • Molecular Weight: 751.9 g/mol
  • Synonyms: TP-7, Selanc, Tuftsin analog, Anxiolytic neuropeptide
Dragon Pharma
  • Active Substance: Semax Heptapeptide
  • Concentration: 5 mg per vial
  • Pack Size: 1 vial (lyophilized powder)
  • Manufacturer: Dragon Pharma
  • Brand Name: Semax
  • Molecular Formula: C37H51N9O10S
  • Molecular Weight: 831.93 g/mol
  • Sequence: Met-Glu-His-Phe-Pro-Gly-Pro
  • Synonyms: ACTH(4-10) analog, Heptapeptide Semax, Cognitive Peptide
Dragon Pharma
  • Active Substance: Sermorelin
  • Concentration: 5 mg per vial
  • Pack Size: 1 vial (lyophilized powder)
  • Manufacturer: Dragon Pharma
  • Brand Name: Sermorelin
  • Molecular Formula: C149H246N44O42
  • Molecular Weight: 3357.89 g/mol
  • Sequence: Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg
  • Synonyms: GHRH(1-29), Growth Hormone Releasing Hormone fragment, Sermorelin Acetate
Dragon Pharma
  • Active Substance: Survodutide
  • Concentration: 10 mg/ml
  • Pack Size: Single vial
  • Manufacturer: Dragon Pharma
  • Brand Name: Survodutide
  • Molecular Formula: C187H293N51O57
  • Molecular Weight: Approx. 4200 g/mol
  • Synonyms: HM15211, Dual GLP-1/Glucagon Agonist, GLP-GCG peptide
Dragon Pharma
  • Active Substance: Thymosin Beta 4 (TB 500)
  • Concentration: 5 mg per vial
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Dragon Pharma
  • Brand Name: TB 500
  • Molecular Formula: C212H350N56O78S
  • Molecular Weight: 4963.49 g/mol
  • Synonyms: TB500, Thymosin Beta-4 Fragment, Fequesetide
Dragon Pharma
  • Active Substance: Tesamorelin
  • Concentration: 5 mg per vial
  • Pack Size: Lyophilized injectable vial
  • Manufacturer: Dragon Pharma
  • Brand Name: Tesamorelin
  • Molecular Formula: C221H366N72O67S
  • Molecular Weight: 5135.91 g/mol
  • Synonyms: Egrifta, GHRH(1–44) analog, GHRH modulator
Dragon Pharma
  • Active Substance: Tirzepatide
  • Concentration: 5 mg per vial
  • Pack Size: Lyophilized injectable vial
  • Manufacturer: Dragon Pharma
  • Brand Name: Tirze-Pep
  • Molecular Formula: C225H348N56O64
  • Molecular Weight: 4813.5 g/mol
  • Synonyms: LY3298176, GLP-1/GIP dual agonist
Peptide Sciences USA

  • Active Substance: 5-Amino-1-methylquinolinium
  • Concentration: 50 mg per capsule
  • Pack Size: 60 capsules
  • Manufacturer: Peptide Sciences USA
  • Brand Name: 5-Amino 1MQ
  • Molecular Formula: C10H11N2
  • Molecular Weight: 159.21 g/mol
  • Synonyms: 5-Amino-1-methylquinolinium, NNMT Inhibitor
Peptide Sciences USA
  • Active Substance: Acetyl hexapeptide-3
  • Concentration: 200 mg
  • Pack Size: Topical formulation
  • Manufacturer: Peptide Sciences USA
  • Brand Name: Argireline
  • Molecular Formula: C34H60N14O12S
  • Molecular Weight: 888.99 g/mol
  • Synonyms: Argireline, Acetyl hexapeptide-8
Peptide Sciences USA
  • Active Substance: Prohibitin-targeting peptide 1
  • Concentration: 10 mg per vial
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: Adipotide
  • Molecular Formula: C152H252N44O42
  • Molecular Weight: 2611.41 g/mol
  • Sequence: CKGGRAKDC-GG-D(KLAKLAK)2
  • Synonyms: FTPP, Fat-Targeted Proapoptotic Peptide, Prohibitin-TP01
Peptide Sciences USA
  • Active Substance: Copper Tripeptide-3
  • Concentration: 200 mg
  • Pack Size: Topical formulation
  • Manufacturer: Peptide Sciences USA
  • Brand Name: AHK
  • Molecular Formula: C15H26CuN6O4
  • Molecular Weight: 416.94 g/mol
  • Sequence: Ala-His-Lys
  • Synonyms: AHK-Cu, Copper Tripeptide-3, Alanine-Histidine-Lysine-Copper
Peptide Sciences USA
  • Active Substance: Copper Tripeptide-3
  • Concentration: 200 mg
  • Pack Size: Topical formulation
  • Manufacturer: Peptide Sciences USA
  • Brand Name: AHK
  • Molecular Formula: C15H26CuN6O4
  • Molecular Weight: 416.94 g/mol
  • Sequence: Ala-His-Lys
  • Synonyms: Copper Tripeptide-3, Alanyl-Histidyl-Lysine-Copper, AHK Copper
Peptide Sciences USA
  • Active Substance: Anti-Obesity Drug-9604
  • Concentration: 6 mg per vial
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: AOD9604
  • Molecular Formula: C78H123N23O23S2
  • Molecular Weight: 1815.08 g/mol
  • Sequence: Tyr-Leu-Arg-Ile-Val-Gln-Cys-Arg-Ser-Val-Glu-Gly-Ser-Cys-Gly-Phe
  • Synonyms: hGH Fragment 177-191, Anti-Obesity Peptide
Peptide Sciences USA
  • Active Substance: ARA290
  • Concentration: 16 mg per vial
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: ARA-290
  • Molecular Formula: C51H84N16O21
  • Molecular Weight: 1257 Da
  • Sequence: Pyroglu-Glu-Gln-Leu-Glu-Arg-Ala-Leu-Asn-Ser-Ser
  • Synonyms: Cibinetide, Pyroglutamate Helix B Surface Peptide
Peptide Sciences USA
  • Active Substance: Relaxin Receptor 1 Agonist
  • Concentration: 6 mg per vial
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: B7-33
  • Molecular Formula: C127H212N44O34
  • Molecular Weight: ~2951 Da
  • Sequence: VIKLSGRELVRAQIAISGMSTWSKRSL
  • Synonyms: (B7-33)H2, Single-Chain Relaxin Analog, GTPL9321
Peptide Sciences USA
  • Active Substance: BPC-157 Pentadecapeptide
  • Concentration: 10 mg per vial
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: BPC 157
  • Molecular Formula: C62H98N16O22
  • Molecular Weight: 1419.54 g/mol
  • Sequence: Gly-Glu-Pro-Pro-Pro-Gly-Lys-Pro-Ala-Pro-Pro-Ala-Glu-Gly-Lys
  • Synonyms: Body Protection Compound-157, Pentadecapeptide BPC
Peptide Sciences USA
  • Active Substance: BPC-157 Pentadecapeptide
  • Concentration: 5 mg per vial
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: BPC 157
  • Molecular Formula: C62H98N16O22
  • Molecular Weight: 1419.54 g/mol
  • Sequence: Gly-Glu-Pro-Pro-Pro-Gly-Lys-Pro-Ala-Pro-Pro-Ala-Glu-Gly-Lys
  • Synonyms: Body Protection Compound-157, Pentadecapeptide BPC
Peptide Sciences USA
  • Active Substance: Thymosin beta 4 / Pentadecapeptide (5 mg BPC-157 + 5 mg TB-500)
  • Concentration: 10 mg per vial (5 mg each peptide)
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: Peptide Blend
  • Molecular Formula (BPC-157): C62H98N16O22
  • Molecular Weight (BPC-157): 1419.54 g/mol
  • Sequence (BPC-157): Gly-Glu-Pro-Pro-Pro-Gly-Lys-Pro-Ala-Pro-Pro-Ala-Glu-Gly-Lys
  • Molecular Formula (TB-500): C38H68N10O14
  • Molecular Weight (TB-500): 889.01 g/mol
  • Sequence (TB-500): Ac-LKKTETQ
  • Synonyms: BPC-157 (Body Protection Compound-157), TB-500 (Thymosin Beta-4 fragment)
Peptide Sciences USA
  • Active Substance: Thymosin beta 4 / Pentadecapeptide (10 mg BPC-157 + 10 mg TB-500)
  • Concentration: 20 mg per vial (10 mg each peptide)
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Molecular Formula (BPC-157): C62H98N16O22
  • Molecular Weight (BPC-157): 1419.54 g/mol
  • Sequence (BPC-157): Gly-Glu-Pro-Pro-Pro-Gly-Lys-Pro-Ala-Pro-Pro-Ala-Glu-Gly-Lys
  • Molecular Formula (TB-500): C38H68N10O14
  • Molecular Weight (TB-500): 889.01 g/mol
  • Sequence (TB-500): Ac-LKKTETQ
  • Synonyms: BPC-157 (Body Protection Compound-157), TB-500 (Thymosin Beta-4 fragment)
Peptide Sciences USA
  • Active Substance: Thymosin beta 4 / Pentadecapeptide / GHK-Cu (10 mg BPC-157 + 10 mg TB-500 + 10 mg GHK-Cu)
  • Concentration: 30 mg per vial (10 mg each peptide)
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: Peptide Blend
  • Molecular Formula (BPC-157): C62H98N16O22
  • Molecular Weight (BPC-157): 1419.54 g/mol
  • Sequence (BPC-157): Gly-Glu-Pro-Pro-Pro-Gly-Lys-Pro-Ala-Pro-Pro-Ala-Glu-Gly-Lys
  • Molecular Formula (TB-500): C38H68N10O14
  • Molecular Weight (TB-500): 889.01 g/mol
  • Sequence (TB-500): Ac-LKKTETQ
  • Molecular Formula (GHK-Cu): C14H24CuN6O4
  • Molecular Weight (GHK-Cu): 340.87 g/mol (excluding copper)
  • Sequence (GHK-Cu): Glycyl-Histidyl-Lysine
  • Synonyms: BPC-157 (Body Protection Compound-157), TB-500 (Thymosin Beta-4 fragment), GHK-Cu (Copper Tripeptide-1)
Peptide Sciences USA
  • Active Substance: Bronchogen
  • Concentration: 20 mg per vial
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: Bronchogen
  • Molecular Formula: C18H30N4O9
  • Molecular Weight: 446.45 g/mol
  • Sequence: Ala-Glu-Asp-Leu
  • Synonyms: AEDL, Bronchial Peptide Bioregulator
Peptide Sciences USA
  • Active Substance: Cagrilintide
  • Concentration: 10 mg per vial
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: Cagrilintide
  • Molecular Formula: C194H312N54O59S2.xC2H4O2
  • Molecular Weight: 4409.01 g/mol
  • Sequence: XKCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP
  • Synonyms: AM833, AT42613
Peptide Sciences USA
  • Active Substance: Cardiogen
  • Concentration: 20 mg per vial
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: Cardiogen
  • Molecular Formula: C18H31N7O9
  • Molecular Weight: 489.5 g/mol
  • Sequence: Ala-Glu-Asp-Arg
Peptide Sciences USA
  • Active Substance: Cartalax
  • Concentration: 20 mg per vial
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: Cartalax
  • Molecular Formula: C12H19N3O8
  • Molecular Weight: 333.29 g/mol
  • Sequence: Ala-Glu-Asp
  • Synonyms: AED, T-31, SCHEMBL5324601
Peptide Sciences USA
  • Active Substance: Chonluten
  • Concentration: 20 mg per vial
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: Chonluten
  • Molecular Formula: C11H17N3O8
  • Molecular Weight: 319.27 g/mol
  • Sequence: Glu-Asp-Gly
  • Synonyms: Tripeptide T-34, EDG, AC-7
Peptide Sciences USA
  • Active Substance: Duo-Blend CJC-1295 No DAC and Ipamorelin (5 mg each)
  • Concentration: 10 mg per vial (5 mg CJC-1295 No DAC + 5 mg Ipamorelin)
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: Peptide Blend
  • Molecular Formula (CJC-1295 No DAC): C152H252N44O42
  • Molecular Weight (CJC-1295 No DAC): 3367.97 g/mol
  • Sequence (CJC-1295 No DAC): H-Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-Ser-Arg-NH2
  • Molecular Formula (Ipamorelin): C38H49N9O5
  • Molecular Weight (Ipamorelin): 711.85 g/mol
  • Sequence (Ipamorelin): Aib-His-D-2-Nal-D-Phe-Lys-NH2
  • Synonyms: CJC-1295 No DAC (Modified GRF 1-29, Sermorelin analog), Ipamorelin (GHRP, Ghrelin mimetic)
Peptide Sciences USA
  • Product Title: CJC-1295 / GHRP-2 10 mg
  • Active Substance: Tetrasubstituted 30-Amino Acid Peptide Hormone / Growth Hormone-Releasing Peptide 2 (5 mg CJC-1295 No DAC + 5 mg GHRP-2)
  • Concentration: 10 mg per vial (5 mg each peptide)
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: Peptide Blend
  • Molecular Formula (CJC-1295 No DAC): C152H252N44O42
  • Molecular Weight (CJC-1295 No DAC): 3367.97 g/mol
  • Sequence (CJC-1295 No DAC): H-Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-Ser-Arg-NH2
  • Molecular Formula (GHRP-2): C45H55N9O6
  • Molecular Weight (GHRP-2): 818.0 g/mol
  • Sequence (GHRP-2): D-Ala-D-2-Nal-Ala-Trp-D-Phe-Lys-NH2
  • Synonyms: CJC-1295 No DAC (Modified GRF 1-29, Sermorelin analog), GHRP-2 (Pralmorelin, Growth Hormone-Releasing Peptide-2)
Showing 50 of 173 products

The Brands category at BuyPeptides.net helps you compare peptides by manufacturer, so you can make informed research decisions. We only feature brands that follow strict manufacturing protocols, offer high batch consistency, and supply complete documentation. Thanks to this brand-based structure, you can quickly find the peptides that best match your research standards and priorities.

Types of Products Available

Our listed brands cover a wide range of peptide types used in scientific, academic, and athletic research. For instance, you'll find:

  • Growth Hormone Secretagogues: CJC-1295, Ipamorelin, and GHRP-6
  • Metabolic and Fat-Loss Peptides: Tesamorelin, AOD-9604, and Fragment 176-191
  • Recovery and Regenerative Peptides: TB-500, BPC-157
  • Melanogenesis Peptides: Melanotan II
  • Nootropic Peptides: Semax and Selank for cognitive research

Each manufacturer focuses on different research applications, so comparing them allows for better experimental planning and result validation.

Benefits of the Products

By shopping according to brand, you gain better control over product origin, purity, and formulation methods. For example, Peptide Sciences maintains rigorous U.S. manufacturing standards, which makes it a reliable choice for high-integrity research. Meanwhile, other brands like Beligas or Dragon Peptides offer excellent peptide value and a broader portfolio.

Across the board, our brand-based selection offers you several benefits:

  • Confidence in consistent peptide purity and quality
  • Clear documentation, including batch numbers and COAs
  • Support for various research areas—metabolic, regenerative, cognitive, and aesthetic
  • Convenient comparison across pricing, dosage, and vial formats

Moreover, choosing trusted brands helps you reduce variability across study cycles, which is critical for long-term experimentation.

Why Buy Research Peptides from Us?

At BuyPeptides.net, we focus on trust, transparency, and high performance. We thoroughly review every brand we carry. From lab documentation to manufacturing quality, we ensure every product meets expectations.

Here's what you can expect when ordering from us:

  • Fast and discreet global shipping—we fulfill most orders within 24 hours.
  • Access to vetted peptide brands—we don't list low-quality or unverified labs.
  • Reliable customer support—our team is here to help you select the right brand for your needs.
  • Secure payments—our checkout system uses the latest SSL encryption for peace of mind.

All of our peptides are intended for laboratory and research purposes only and are not sold for human or veterinary use. Choose your preferred brand now and support your research with confidence.