Home
About Us
FAQs
Articles
Contacts
News
Hello, Log In My Account
Shopping Cart $0.00
Subtotal $0.00
Shipping $0.00
Total $0.00
View Cart Checkout

Peptide Sciences

Peptide Sciences is one of the most recognized names in the peptide research industry. Known for its U.S.-based manufacturing and pharmaceutical-grade quality, this brand is a top choice among academic labs and research professionals. With a wide selection of high-purity compounds, Peptide Sciences ensures consistent results backed by independent testing.
Explore the full range and buy directly from an authorized distributor.

Filters

Filters

Showing 50 of 140 products
Image
SKU
Product
Rating
Price
5-Amino-1MQ 50 mg - Peptide Sciences USA Research Peptides
Peptide Sciences USA

  • Active Substance: 5-Amino-1-methylquinolinium
  • Concentration: 50 mg per capsule
  • Pack Size: 60 capsules
  • Manufacturer: Peptide Sciences USA
  • Brand Name: 5-Amino 1MQ
  • Molecular Formula: C10H11N2
  • Molecular Weight: 159.21 g/mol
  • Synonyms: 5-Amino-1-methylquinolinium, NNMT Inhibitor
Out of Stock
Acetyl Hexapeptide-3 200 mg - Peptide Sciences USA Research Peptides
Peptide Sciences USA
  • Active Substance: Acetyl hexapeptide-3
  • Concentration: 200 mg
  • Pack Size: Topical formulation
  • Manufacturer: Peptide Sciences USA
  • Brand Name: Argireline
  • Molecular Formula: C34H60N14O12S
  • Molecular Weight: 888.99 g/mol
  • Synonyms: Argireline, Acetyl hexapeptide-8
Out of Stock
Adipotide (FTPP) 10mg - Peptide Sciences USA Research Peptides
Peptide Sciences USA
  • Active Substance: Prohibitin-targeting peptide 1
  • Concentration: 10 mg per vial
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: Adipotide
  • Molecular Formula: C152H252N44O42
  • Molecular Weight: 2611.41 g/mol
  • Sequence: CKGGRAKDC-GG-D(KLAKLAK)2
  • Synonyms: FTPP, Fat-Targeted Proapoptotic Peptide, Prohibitin-TP01
Out of Stock
AHK (Tripeptide-3) 200 mg - Peptide Sciences USA Research Peptides
Peptide Sciences USA
  • Active Substance: Copper Tripeptide-3
  • Concentration: 200 mg
  • Pack Size: Topical formulation
  • Manufacturer: Peptide Sciences USA
  • Brand Name: AHK
  • Molecular Formula: C15H26CuN6O4
  • Molecular Weight: 416.94 g/mol
  • Sequence: Ala-His-Lys
  • Synonyms: AHK-Cu, Copper Tripeptide-3, Alanine-Histidine-Lysine-Copper
Out of Stock
AHK-Cu 200 mg - Peptide Sciences USA Research Peptides
Peptide Sciences USA
  • Active Substance: Copper Tripeptide-3
  • Concentration: 200 mg
  • Pack Size: Topical formulation
  • Manufacturer: Peptide Sciences USA
  • Brand Name: AHK
  • Molecular Formula: C15H26CuN6O4
  • Molecular Weight: 416.94 g/mol
  • Sequence: Ala-His-Lys
  • Synonyms: Copper Tripeptide-3, Alanyl-Histidyl-Lysine-Copper, AHK Copper
Out of Stock
AOD9604 6 mg - Peptide Sciences USA Research Peptides
Peptide Sciences USA
  • Active Substance: Anti-Obesity Drug-9604
  • Concentration: 6 mg per vial
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: AOD9604
  • Molecular Formula: C78H123N23O23S2
  • Molecular Weight: 1815.08 g/mol
  • Sequence: Tyr-Leu-Arg-Ile-Val-Gln-Cys-Arg-Ser-Val-Glu-Gly-Ser-Cys-Gly-Phe
  • Synonyms: hGH Fragment 177-191, Anti-Obesity Peptide
Out of Stock
ARA-290 - Peptide Sciences USA Research Peptides
Peptide Sciences USA
  • Active Substance: ARA290
  • Concentration: 16 mg per vial
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: ARA-290
  • Molecular Formula: C51H84N16O21
  • Molecular Weight: 1257 Da
  • Sequence: Pyroglu-Glu-Gln-Leu-Glu-Arg-Ala-Leu-Asn-Ser-Ser
  • Synonyms: Cibinetide, Pyroglutamate Helix B Surface Peptide
Out of Stock
B7-33 6 mg - Peptide Sciences USA Research Peptides
Peptide Sciences USA
  • Active Substance: Relaxin Receptor 1 Agonist
  • Concentration: 6 mg per vial
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: B7-33
  • Molecular Formula: C127H212N44O34
  • Molecular Weight: ~2951 Da
  • Sequence: VIKLSGRELVRAQIAISGMSTWSKRSL
  • Synonyms: (B7-33)H2, Single-Chain Relaxin Analog, GTPL9321
Out of Stock
BPC-157 10 mg - Peptide Sciences USA Research Peptides
Peptide Sciences USA
  • Active Substance: BPC-157 Pentadecapeptide
  • Concentration: 10 mg per vial
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: BPC 157
  • Molecular Formula: C62H98N16O22
  • Molecular Weight: 1419.54 g/mol
  • Sequence: Gly-Glu-Pro-Pro-Pro-Gly-Lys-Pro-Ala-Pro-Pro-Ala-Glu-Gly-Lys
  • Synonyms: Body Protection Compound-157, Pentadecapeptide BPC
Out of Stock
BPC-157 5 mg - Peptide Sciences USA Research Peptides
Peptide Sciences USA
  • Active Substance: BPC-157 Pentadecapeptide
  • Concentration: 5 mg per vial
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: BPC 157
  • Molecular Formula: C62H98N16O22
  • Molecular Weight: 1419.54 g/mol
  • Sequence: Gly-Glu-Pro-Pro-Pro-Gly-Lys-Pro-Ala-Pro-Pro-Ala-Glu-Gly-Lys
  • Synonyms: Body Protection Compound-157, Pentadecapeptide BPC
Out of Stock
BPC-157/TB-500 10 mg Blend - Peptide Sciences USA Research Peptides
Peptide Sciences USA
  • Active Substance: Thymosin beta 4 / Pentadecapeptide (5 mg BPC-157 + 5 mg TB-500)
  • Concentration: 10 mg per vial (5 mg each peptide)
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: Peptide Blend
  • Molecular Formula (BPC-157): C62H98N16O22
  • Molecular Weight (BPC-157): 1419.54 g/mol
  • Sequence (BPC-157): Gly-Glu-Pro-Pro-Pro-Gly-Lys-Pro-Ala-Pro-Pro-Ala-Glu-Gly-Lys
  • Molecular Formula (TB-500): C38H68N10O14
  • Molecular Weight (TB-500): 889.01 g/mol
  • Sequence (TB-500): Ac-LKKTETQ
  • Synonyms: BPC-157 (Body Protection Compound-157), TB-500 (Thymosin Beta-4 fragment)
Out of Stock
BPC-157/TB-500 20 mg Blend - Peptide Sciences USA Research Peptides
Peptide Sciences USA
  • Active Substance: Thymosin beta 4 / Pentadecapeptide (10 mg BPC-157 + 10 mg TB-500)
  • Concentration: 20 mg per vial (10 mg each peptide)
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Molecular Formula (BPC-157): C62H98N16O22
  • Molecular Weight (BPC-157): 1419.54 g/mol
  • Sequence (BPC-157): Gly-Glu-Pro-Pro-Pro-Gly-Lys-Pro-Ala-Pro-Pro-Ala-Glu-Gly-Lys
  • Molecular Formula (TB-500): C38H68N10O14
  • Molecular Weight (TB-500): 889.01 g/mol
  • Sequence (TB-500): Ac-LKKTETQ
  • Synonyms: BPC-157 (Body Protection Compound-157), TB-500 (Thymosin Beta-4 fragment)
Out of Stock
BPC-157/TB-500/GHK-Cu 30 mg - Peptide Sciences USA Research Peptides
Peptide Sciences USA
  • Active Substance: Thymosin beta 4 / Pentadecapeptide / GHK-Cu (10 mg BPC-157 + 10 mg TB-500 + 10 mg GHK-Cu)
  • Concentration: 30 mg per vial (10 mg each peptide)
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: Peptide Blend
  • Molecular Formula (BPC-157): C62H98N16O22
  • Molecular Weight (BPC-157): 1419.54 g/mol
  • Sequence (BPC-157): Gly-Glu-Pro-Pro-Pro-Gly-Lys-Pro-Ala-Pro-Pro-Ala-Glu-Gly-Lys
  • Molecular Formula (TB-500): C38H68N10O14
  • Molecular Weight (TB-500): 889.01 g/mol
  • Sequence (TB-500): Ac-LKKTETQ
  • Molecular Formula (GHK-Cu): C14H24CuN6O4
  • Molecular Weight (GHK-Cu): 340.87 g/mol (excluding copper)
  • Sequence (GHK-Cu): Glycyl-Histidyl-Lysine
  • Synonyms: BPC-157 (Body Protection Compound-157), TB-500 (Thymosin Beta-4 fragment), GHK-Cu (Copper Tripeptide-1)
Out of Stock
Bronchogen 20 mg - Peptide Sciences USA Research Peptides
Peptide Sciences USA
  • Active Substance: Bronchogen
  • Concentration: 20 mg per vial
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: Bronchogen
  • Molecular Formula: C18H30N4O9
  • Molecular Weight: 446.45 g/mol
  • Sequence: Ala-Glu-Asp-Leu
  • Synonyms: AEDL, Bronchial Peptide Bioregulator
Out of Stock
Cagrilintide 10 mg - Peptide Sciences USA Research Peptides
Peptide Sciences USA
  • Active Substance: Cagrilintide
  • Concentration: 10 mg per vial
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: Cagrilintide
  • Molecular Formula: C194H312N54O59S2.xC2H4O2
  • Molecular Weight: 4409.01 g/mol
  • Sequence: XKCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP
  • Synonyms: AM833, AT42613
Out of Stock
Cardiogen 20 mg - Peptide Sciences USA Research Peptides
Peptide Sciences USA
  • Active Substance: Cardiogen
  • Concentration: 20 mg per vial
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: Cardiogen
  • Molecular Formula: C18H31N7O9
  • Molecular Weight: 489.5 g/mol
  • Sequence: Ala-Glu-Asp-Arg
Out of Stock
Cartalax 20 mg - Peptide Sciences USA Research Peptides
Peptide Sciences USA
  • Active Substance: Cartalax
  • Concentration: 20 mg per vial
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: Cartalax
  • Molecular Formula: C12H19N3O8
  • Molecular Weight: 333.29 g/mol
  • Sequence: Ala-Glu-Asp
  • Synonyms: AED, T-31, SCHEMBL5324601
Out of Stock
Chonluten 20 mg - Peptide Sciences USA Research Peptides
Peptide Sciences USA
  • Active Substance: Chonluten
  • Concentration: 20 mg per vial
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: Chonluten
  • Molecular Formula: C11H17N3O8
  • Molecular Weight: 319.27 g/mol
  • Sequence: Glu-Asp-Gly
  • Synonyms: Tripeptide T-34, EDG, AC-7
Out of Stock
CJC-1295 (No DAC) / Ipamorelin 10 mg - Peptide Sciences USA Research Peptides
Peptide Sciences USA
  • Active Substance: Duo-Blend CJC-1295 No DAC and Ipamorelin (5 mg each)
  • Concentration: 10 mg per vial (5 mg CJC-1295 No DAC + 5 mg Ipamorelin)
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: Peptide Blend
  • Molecular Formula (CJC-1295 No DAC): C152H252N44O42
  • Molecular Weight (CJC-1295 No DAC): 3367.97 g/mol
  • Sequence (CJC-1295 No DAC): H-Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-Ser-Arg-NH2
  • Molecular Formula (Ipamorelin): C38H49N9O5
  • Molecular Weight (Ipamorelin): 711.85 g/mol
  • Sequence (Ipamorelin): Aib-His-D-2-Nal-D-Phe-Lys-NH2
  • Synonyms: CJC-1295 No DAC (Modified GRF 1-29, Sermorelin analog), Ipamorelin (GHRP, Ghrelin mimetic)
Out of Stock
CJC-1295 / GHRP-6 10 mg - Peptide Sciences USA Research Peptides
Peptide Sciences USA
  • Product Title: CJC-1295 / GHRP-2 10 mg
  • Active Substance: Tetrasubstituted 30-Amino Acid Peptide Hormone / Growth Hormone-Releasing Peptide 2 (5 mg CJC-1295 No DAC + 5 mg GHRP-2)
  • Concentration: 10 mg per vial (5 mg each peptide)
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: Peptide Blend
  • Molecular Formula (CJC-1295 No DAC): C152H252N44O42
  • Molecular Weight (CJC-1295 No DAC): 3367.97 g/mol
  • Sequence (CJC-1295 No DAC): H-Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-Ser-Arg-NH2
  • Molecular Formula (GHRP-2): C45H55N9O6
  • Molecular Weight (GHRP-2): 818.0 g/mol
  • Sequence (GHRP-2): D-Ala-D-2-Nal-Ala-Trp-D-Phe-Lys-NH2
  • Synonyms: CJC-1295 No DAC (Modified GRF 1-29, Sermorelin analog), GHRP-2 (Pralmorelin, Growth Hormone-Releasing Peptide-2)
Out of Stock
CJC-1295 / Hexarelin 10 mg - Peptide Sciences USA Research Peptides
Peptide Sciences USA
  • Product Title: CJC-1295 / Hexarelin 10 mg
  • Active Substance: Duo-Blend CJC-1295 No DAC and Hexarelin (5 mg each)
  • Concentration: 10 mg per vial (5 mg CJC-1295 No DAC + 5 mg Hexarelin)
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: Peptide Blend
  • Molecular Formula (CJC-1295 No DAC): C152H252N44O42
  • Molecular Weight (CJC-1295 No DAC): 3367.97 g/mol
  • Sequence (CJC-1295 No DAC): H-Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-Ser-Arg-NH2
  • Molecular Formula (Hexarelin): C47H58N12O6
  • Molecular Weight (Hexarelin): 887.04 g/mol
  • Sequence (Hexarelin): His-D-2-methyl-Trp-Ala-Trp-D-Phe-Lys-NH2
  • Synonyms: CJC-1295 No DAC (Modified GRF 1-29, Sermorelin analog), Hexarelin (Examorelin, Growth Hormone-Releasing Hexapeptide)
Out of Stock
CJC-1295 no DAC 2 mg - Peptide Sciences USA Research Peptides
Peptide Sciences USA
  • Active Substance: CJC-1295 No DAC
  • Concentration: 2 mg per vial
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: Mod GRF (1-29)
  • Molecular Formula: C152H252N44O42
  • Molecular Weight: 3367.97 g/mol
  • Sequence: H-Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-Ser-Arg-NH2
  • Synonyms: Modified GRF (1-29), Sermorelin analog
Out of Stock
CJC1295 / Ipamorelin / GHRP-2 - Peptide Sciences USA Research Peptides
Peptide Sciences USA
  • Active Substance: CJC-1295 DAC / Ipamorelin / GHRP-2 (3 mg each)
  • Concentration: 9 mg per vial (3 mg CJC-1295 DAC + 3 mg Ipamorelin + 3 mg GHRP-2)
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: Peptide Blend
  • Molecular Formula (CJC-1295 DAC): C152H252N44O42 (with DAC modification)
  • Molecular Weight (CJC-1295 DAC): ~3367.97 g/mol
  • Sequence (CJC-1295 DAC): H-Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-Ser-Arg-Lys(Maleimidopropionyl)-NH2
  • Molecular Formula (Ipamorelin): C38H49N9O5
  • Molecular Weight (Ipamorelin): 711.85 g/mol
  • Sequence (Ipamorelin): Aib-His-D-2-Nal-D-Phe-Lys-NH2
  • Molecular Formula (GHRP-2): C45H55N9O6
  • Molecular Weight (GHRP-2): 818.0 g/mol
  • Sequence (GHRP-2): D-Ala-D-2-Nal-Ala-Trp-D-Phe-Lys-NH2
  • Synonyms: CJC-1295 DAC (DAC:GRF), Ipamorelin (GHRP, Ghrelin mimetic), GHRP-2 (Pralmorelin)
Out of Stock
Cortagen 20 mg - Peptide Sciences USA Research Peptides
Peptide Sciences USA
  • Active Substance: Cortagen
  • Concentration: 20 mg per vial
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: Cortagen
  • Molecular Formula: C17H27N5O8
  • Molecular Weight: 430.17 g/mol
  • Sequence: Ala-Glu-Asp-Pro
  • Synonyms: AEDP, SCHEMBL5491754
Out of Stock
Decapeptide-12 - Peptide Sciences USA Research Peptides
Peptide Sciences USA
  • Product Title: Decapeptide-12
  • Active Substance: Decapeptide-12
  • Concentration: 200 mg
  • Pack Size: Topical
  • Manufacturer: Peptide Sciences USA
  • Brand Name: Decapeptide
  • Molecular Formula: C65H90N18O17
  • Molecular Weight: 1311.46 g/mol
  • Sequence: Tyr-Arg-Ser-Arg-Lys-Tyr-Ser-Ser-Trp-Tyr
  • Synonyms: YRSRKYSSWY, Lumixyl
Out of Stock
DSIP 5 mg - Peptide Sciences USA Research Peptides
Peptide Sciences USA
  • Active Substance: Delta-sleep-inducing peptide
  • Concentration: 5 mg per vial
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: DSIP
  • Molecular Formula: C35H48N10O15
  • Molecular Weight: 848.81 g/mol
  • Sequence: Trp-Ala-Gly-Gly-Asp-Ala-Ser-Gly-Glu
  • Synonyms: Delta-sleep-inducing peptide, WAGGDASGE
Out of Stock
Duo-Blend Mod GRF / GHRP-2 10 mg - Peptide Sciences USA Research Peptides
Peptide Sciences USA
  • Active Substance: Modified GRF (CJC-1295 No DAC) and GHRP-2 (5 mg each)
  • Concentration: 10 mg per vial (5 mg Mod GRF + 5 mg GHRP-2)
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: Peptide Blend
  • Molecular Formula (Mod GRF): C152H252N44O42
  • Molecular Weight (Mod GRF): 3367.97 g/mol
  • Sequence (Mod GRF): H-Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-Ser-Arg-NH2
  • Molecular Formula (GHRP-2): C45H55N9O6
  • Molecular Weight (GHRP-2): 818.0 g/mol
  • Sequence (GHRP-2): D-Ala-D-2-Nal-Ala-Trp-D-Phe-Lys-NH2
  • Synonyms: Mod GRF (CJC-1295 No DAC, Sermorelin analog), GHRP-2 (Pralmorelin)
Out of Stock
Duo-Blend Mod GRF / GHRP-6 10 mg - Peptide Sciences USA Research Peptides
Peptide Sciences USA
  • Active Substance: Modified GRF (CJC-1295 No DAC) and GHRP-6 (5 mg each)
  • Concentration: 10 mg per vial (5 mg Mod GRF + 5 mg GHRP-6)
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: Peptide Blend
  • Molecular Formula (Mod GRF): C152H252N44O42
  • Molecular Weight (Mod GRF): 3367.97 g/mol
  • Sequence (Mod GRF): H-Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-Ser-Arg-NH2
  • Molecular Formula (GHRP-6): C46H56N12O6
  • Molecular Weight (GHRP-6): 873.01 g/mol
  • Sequence (GHRP-6): His-D-Trp-Ala-Trp-D-Phe-Lys-NH2
  • Synonyms: Mod GRF (CJC-1295 No DAC, Sermorelin analog), GHRP-6 (Growth Hormone-Releasing Hexapeptide)
Out of Stock
Duo-Blend Mod GRF / Hexarelin 10mg - Peptide Sciences USA Research Peptides
Peptide Sciences USA
  • Active Substance: Modified GRF (CJC-1295 No DAC) and Hexarelin (5 mg each)
  • Concentration: 10 mg per vial (5 mg Mod GRF + 5 mg Hexarelin)
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: Peptide Blend
  • Molecular Formula (Mod GRF): C152H252N44O42
  • Molecular Weight (Mod GRF): 3367.97 g/mol
  • Sequence (Mod GRF): H-Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-Ser-Arg-NH2
  • Molecular Formula (Hexarelin): C47H58N12O6
  • Molecular Weight (Hexarelin): 887.04 g/mol
  • Sequence (Hexarelin): His-D-2-methyl-Trp-Ala-Trp-D-Phe-Lys-NH2
  • Synonyms: Mod GRF (CJC-1295 No DAC, Sermorelin analog), Hexarelin (Examorelin)
  • PubChem CID (Hexarelin): 5464109
Out of Stock
Duo-Blend Mod GRF / Ipamorelin 10 mg - Peptide Sciences USA Research Peptides
Peptide Sciences USA
  • Active Substance: Modified GRF (CJC-1295 No DAC) and Ipamorelin (5 mg each)
  • Concentration: 10 mg per vial (5 mg Mod GRF + 5 mg Ipamorelin)
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: Peptide Blend
  • Molecular Formula (Mod GRF): C152H252N44O42
  • Molecular Weight (Mod GRF): 3367.97 g/mol
  • Sequence (Mod GRF): H-Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-Ser-Arg-NH2
  • Molecular Formula (Ipamorelin): C38H49N9O5
  • Molecular Weight (Ipamorelin): 711.85 g/mol
  • Sequence (Ipamorelin): Aib-His-D-2-Nal-D-Phe-Lys-NH2
  • Synonyms: Mod GRF (CJC-1295 No DAC, Sermorelin analog), Ipamorelin (GHRP, Ghrelin mimetic)
Out of Stock
Duo-Blend Sermorelin / GHRP-2 10 mg - Peptide Sciences USA Research Peptides
Peptide Sciences USA
  • Active Substance: Sermorelin (Mod GRF, GHRH 1-29) and GHRP-2 (5 mg each)
  • Concentration: 10 mg per vial (5 mg Sermorelin + 5 mg GHRP-2)
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: Peptide Blend
  • Molecular Formula (Sermorelin): C149H246N44O42S
  • Molecular Weight (Sermorelin): 3357.93 g/mol
  • Sequence (Sermorelin): Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-NH2
  • Molecular Formula (GHRP-2): C45H55N9O6
  • Molecular Weight (GHRP-2): 818.0 g/mol
  • Sequence (GHRP-2): D-Ala-D-2-Nal-Ala-Trp-D-Phe-Lys-NH2
  • Synonyms: Sermorelin (GHRH 1-29, Mod GRF), GHRP-2 (Pralmorelin)
Out of Stock
Duo-Blend Sermorelin / GHRP-6 10 mg - Peptide Sciences USA Research Peptides
Peptide Sciences USA
  • Active Substance: Sermorelin (GHRH 1-29) and GHRP-6 (5 mg each)
  • Concentration: 10 mg per vial (5 mg Sermorelin + 5 mg GHRP-6)
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: Peptide Blend
  • Molecular Formula (Sermorelin): C149H246N44O42S
  • Molecular Weight (Sermorelin): 3357.93 g/mol
  • Sequence (Sermorelin): Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-NH2
  • Molecular Formula (GHRP-6): C46H56N12O6
  • Molecular Weight (GHRP-6): 873.01 g/mol
  • Sequence (GHRP-6): His-D-Trp-Ala-Trp-D-Phe-Lys-NH2
  • Synonyms: Sermorelin (GHRH 1-29, Mod GRF), GHRP-6 (Growth Hormone-Releasing Hexapeptide)
Out of Stock
Duo-Blend Sermorelin / Ipamorelin 10 mg - Peptide Sciences USA Research Peptides
Peptide Sciences USA
  • Active Substance: Sermorelin (GHRH 1-29) and Ipamorelin (5 mg each)
  • Concentration: 10 mg per vial (5 mg Sermorelin + 5 mg Ipamorelin)
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: Peptide Blend
  • Molecular Formula (Sermorelin): C149H246N44O42S
  • Molecular Weight (Sermorelin): 3357.93 g/mol
  • Sequence (Sermorelin): Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-NH2
  • Molecular Formula (Ipamorelin): C38H49N9O5
  • Molecular Weight (Ipamorelin): 711.85 g/mol
  • Sequence (Ipamorelin): Aib-His-D-2-Nal-D-Phe-Lys-NH2
  • Synonyms: Sermorelin (GHRH 1-29, Mod GRF), Ipamorelin (GHRP, Ghrelin mimetic)
Out of Stock
Duo-Blend Tesamorelin / Ipamorelin 8 mg - Peptide Sciences USA Research Peptides
Peptide Sciences USA
  • Active Substance: Tesamorelin (6 mg) and Ipamorelin (2 mg)
  • Concentration: 8 mg per vial (6 mg Tesamorelin + 2 mg Ipamorelin)
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: Peptide Blend
  • Molecular Formula (Tesamorelin): C221H366N72O67S
  • Molecular Weight (Tesamorelin): 5135.86 g/mol
  • Sequence (Tesamorelin): Unk-Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-Gln-Gln-Gly-Glu-Ser-Asn-Gln-Glu-Arg-Gly-Ala-Arg-Ala-Arg-Leu-NH2
  • Molecular Formula (Ipamorelin): C38H49N9O5
  • Molecular Weight (Ipamorelin): 711.85 g/mol
  • Sequence (Ipamorelin): Aib-His-D-2-Nal-D-Phe-Lys-NH2
  • Synonyms: Tesamorelin (Egrifta, TH9507), Ipamorelin (GHRP, Ghrelin mimetic)
Out of Stock
Epitalon 3 mg Capsule - Peptide Sciences USA Research Peptides
Peptide Sciences USA
  • Active Substance: Epitalon
  • Concentration: 3 mg per capsule
  • Pack Size: 60 capsules
  • Manufacturer: Peptide Sciences USA
  • Brand Name: Epitalon
  • Molecular Formula: C14H22N4O9
  • Molecular Weight: 390.35 g/mol
  • Sequence: Ala-Glu-Asp-Gly
  • Synonyms: Epithalon, AEDG, Epithalamin analog
Out of Stock
Epithalon 50 mg - Peptide Sciences USA Research Peptides
Peptide Sciences USA
  • Active Substance: Epitalon
  • Concentration: 50 mg per vial
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: Epitalon
  • Molecular Formula: C14H22N4O9
  • Molecular Weight: 390.35 g/mol
  • Sequence: Ala-Glu-Asp-Gly
  • Synonyms: Epithalon, AEDG, Epithalamin analog
Out of Stock
FOX04-DRI 10 mg - Peptide Sciences USA Research Peptides
Peptide Sciences USA
  • Active Substance: Proxofim (FOXO4-D-Retro-Inverso)
  • Concentration: 10 mg per vial
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: Proxofim
  • Molecular Formula: C228H388N86O64
  • Molecular Weight: 5358.05 g/mol
  • Sequence: H-D-Leu-D-Thr-D-Leu-D-Arg-D-Lys-D-Glu-D-Pro-D-Ala-D-Ser-D-Glu-D-Ile-D-Ala-D-Gln-D-Ser-D-Ile-D-Leu-D-Glu-D-Ala-D-Tyr-D-Ser-D-Gln-D-Asn-D-Gly-D-Trp-D-Ala-D-Asn-D-Arg-D-Arg-D-Ser-D-Gly-D-Gly-D-Lys-D-Arg-D-Pro-D-Pro-D-Pro-D-Arg-D-Arg-D-Arg-D-Gln-D-Arg-D-Arg-D-Lys-D-Lys-D-Arg-D-Gly-OH
  • Synonyms: Forkhead box protein O4 D-Retro-Inverso, FOXO4a, AFX, AFX1, MLLT7
Out of Stock
Fragment / Modified GRF / Ipamorelin 12 mg - Peptide Sciences USA Research Peptides
Peptide Sciences USA
  • Active Substance: HGH Fragment 176-191 (6 mg), Modified GRF (CJC-1295 No DAC, 3 mg), Ipamorelin (3 mg)
  • Concentration: 12 mg per vial (6 mg HGH Fragment 176-191 + 3 mg Modified GRF + 3 mg Ipamorelin)
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: Peptide Blend
  • Molecular Formula (HGH Fragment 176-191): C78H125N24O24S2
  • Molecular Weight (HGH Fragment 176-191): 1817.12 g/mol
  • Sequence (HGH Fragment 176-191): Tyr-Leu-Arg-Ile-Val-Gln-Cys-Arg-Ser-Val-Glu-Gly-Ser-Cys-Gly-Phe
  • Molecular Formula (Modified GRF): C152H252N44O42
  • Molecular Weight (Modified GRF): 3367.97 g/mol
  • Sequence (Modified GRF): H-Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-Ser-Arg-NH2
  • Molecular Formula (Ipamorelin): C38H49N9O5
  • Molecular Weight (Ipamorelin): 711.85 g/mol
  • Sequence (Ipamorelin): Aib-His-D-2-Nal-D-Phe-Lys-NH2
  • Synonyms: HGH Fragment 176-191 (AOD9604), Modified GRF (CJC-1295 No DAC), Ipamorelin (GHRP, Ghrelin mimetic)
Out of Stock
Fragment / CJC1295 / Ipamorelin 12 mg - Peptide Sciences USA Research Peptides
Peptide Sciences USA
  • Active Substance: HGH Fragment 176-191 (6 mg), CJC1295 No DAC (3 mg), Ipamorelin (3 mg)
  • Concentration: 12 mg per vial (6 mg HGH Fragment 176-191 + 3 mg CJC1295 + 3 mg Ipamorelin)
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: Peptide Blend
  • Molecular Formula (HGH Fragment 176-191): C78H125N24O24S2
  • Molecular Weight (HGH Fragment 176-191): 1817.12 g/mol
  • Sequence (HGH Fragment 176-191): Tyr-Leu-Arg-Ile-Val-Gln-Cys-Arg-Ser-Val-Glu-Gly-Ser-Cys-Gly-Phe
  • Molecular Formula (CJC1295 No DAC): C152H252N44O42
  • Molecular Weight (CJC1295 No DAC): 3367.97 g/mol
  • Sequence (CJC1295 No DAC): H-Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-Ser-Arg-NH2
  • Molecular Formula (Ipamorelin): C38H49N9O5
  • Molecular Weight (Ipamorelin): 711.85 g/mol
  • Sequence (Ipamorelin): Aib-His-D-2-Nal-D-Phe-Lys-NH2
  • Synonyms: HGH Fragment 176-191 (AOD9604), CJC1295 No DAC (Mod GRF), Ipamorelin (GHRP, Ghrelin mimetic)
Out of Stock
GHK Basic 200 mg - Peptide Sciences USA Research Peptides
Peptide Sciences USA
  • Active Substance: Tripeptide-1 (Glycyl-L-Histidyl-L-Lysine)
  • Concentration: 200 mg per vial
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: GHK Basic
  • Molecular Formula: C14H24N6O4
  • Molecular Weight: 340.38 g/mol
  • Sequence: Gly-His-Lys
  • Synonyms: GHK, Glycyl-L-Histidyl-L-Lysine, Tripeptide-1
Out of Stock
GHK Basic 50 mg - Peptide Sciences USA Research Peptides
Peptide Sciences USA
  • Active Substance: Tripeptide-1 (Glycyl-L-Histidyl-L-Lysine)
  • Concentration: 50 mg per vial
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: GHK Basic
  • Molecular Formula: C14H24N6O4
  • Molecular Weight: 340.38 g/mol
  • Sequence: Gly-His-Lys
  • Synonyms: GHK, Glycyl-L-Histidyl-L-Lysine, Tripeptide-1
Out of Stock
GHK-Cu 1000 mg - Peptide Sciences USA Research Peptides
Peptide Sciences USA
  • Active Substance: Glycyl-L-Histidyl-L-Lysine Copper Complex (GHK-Cu)
  • Concentration: 1000 mg per container
  • Pack Size: Topical formulation
  • Manufacturer: Peptide Sciences USA
  • Brand Name: GHK-Cu
  • Molecular Formula: C14H22N6O4Cu
  • Molecular Weight: ~403 g/mol
  • Sequence: Gly-His-Lys-Cu
  • Synonyms: Copper Tripeptide-1, GHK Copper Peptide
Out of Stock
GHK-Cu 2 mg - Peptide Sciences USA Research Peptides
Peptide Sciences USA
  • Active Substance: Glycyl-L-Histidyl-L-Lysine Copper Complex (GHK-Cu)
  • Concentration: 2 mg per capsule
  • Pack Size: 60 capsules
  • Manufacturer: Peptide Sciences USA
  • Brand Name: GHK-Cu
  • Categories: Oral Peptides, Immune & Longevity Support Peptides, Anti-Aging & Skin Health Peptides
  • Molecular Formula: C14H22N6O4Cu
  • Molecular Weight: ~403 g/mol
  • Sequence: Gly-His-Lys-Cu
  • Synonyms: Copper Tripeptide-1, GHK Copper Peptide
Out of Stock
GHK-Cu 200 mg - Peptide Sciences USA Research Peptides
Peptide Sciences USA
  • Active Substance: Glycyl-L-Histidyl-L-Lysine Copper Complex (GHK-Cu)
  • Concentration: 200 mg per container
  • Pack Size: Single container (lyophilized powder for topical formulation)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: GHK-Cu
  • Molecular Formula: C14H22N6O4Cu
  • Molecular Weight: ~403 g/mol
  • Sequence: Gly-His-Lys-Cu
  • Synonyms: Copper Tripeptide-1, GHK Copper Peptide
Out of Stock
GHK-Cu 50 mg - Peptide Sciences USA Research Peptides
Peptide Sciences USA
  • Active Substance: Glycyl-L-Histidyl-L-Lysine Copper Complex (GHK-Cu)
  • Concentration: 50 mg per vial
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: GHK-Cu
  • Molecular Formula: C14H22N6O4Cu
  • Molecular Weight: ~403 g/mol
  • Sequence: Gly-His-Lys-Cu
  • Synonyms: Copper Tripeptide-1, GHK Copper Peptide
Out of Stock
GHK-Cu 500 mg - Peptide Sciences USA Research Peptides
Peptide Sciences USA
  • Active Substance: Glycyl-L-Histidyl-L-Lysine Copper Complex (GHK-Cu)
  • Concentration: 500 mg per container
  • Pack Size: Single container (lyophilized powder for topical formulation)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: GHK-Cu
  • Molecular Formula: C14H22N6O4Cu
  • Molecular Weight: ~403 g/mol
  • Sequence: Gly-His-Lys-Cu
  • Synonyms: Copper Tripeptide-1, GHK Copper Peptide
Out of Stock
GHRH 5 mg - Peptide Sciences USA Research Peptides
Peptide Sciences USA
  • Active Substance: Growth Hormone–Releasing Hormone (Sermorelin analog)
  • Concentration: 5 mg per vial
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: Somatoliberin
  • Molecular Formula: C149H246N44O42S
  • Molecular Weight: 3357.93 g/mol
  • Sequence: Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-NH2
  • Synonyms: Somatoliberin, Sermorelin, GHRH 1-29
Out of Stock
GHRP-2 10 mg - Peptide Sciences USA Research Peptides
Peptide Sciences USA
  • Active Substance: Growth Hormone-Releasing Peptide 2 (GHRP-2)
  • Concentration: 10 mg per vial
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: GHRP-2
  • Molecular Formula: C45H55N9O6
  • Molecular Weight: 818.0 g/mol
  • Sequence: D-Ala-D-2-Nal-Ala-Trp-D-Phe-Lys-NH2
  • Synonyms: Pralmorelin, Growth Hormone Secretagogue
Out of Stock
GHRP-2 5 mg - Peptide Sciences USA Research Peptides
Peptide Sciences USA
  • Active Substance: Growth Hormone-Releasing Peptide 2 (GHRP-2)
  • Concentration: 5 mg per vial
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: GHRP-2
  • Molecular Formula: C45H55N9O6
  • Molecular Weight: 818.0 g/mol
  • Sequence: D-Ala-D-2-Nal-Ala-Trp-D-Phe-Lys-NH2
  • Synonyms: Pralmorelin, Growth Hormone Secretagogue
Out of Stock
GHRP-6 10 mg - Peptide Sciences USA Research Peptides
Peptide Sciences USA
  • Active Substance: Growth Hormone-Releasing Peptide 6 (GHRP-6)
  • Concentration: 10 mg per vial
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: GHRP-6
  • Molecular Formula: C46H56N12O6
  • Molecular Weight: 873.01 g/mol
  • Sequence: His-D-Trp-Ala-Trp-D-Phe-Lys-NH2
  • Synonyms: Growth Hormone Secretagogue, GHRP-6
Out of Stock
Showing 50 of 140 products

Peptide Sciences is a U.S.-based peptide manufacturer specializing in high-purity compounds for scientific and laboratory use. Founded with the mission to deliver pharmaceutical-grade peptides with transparent sourcing, Peptide Sciences has become a leading brand for researchers who demand consistency, documentation, and quality. All of their products are synthesized in ISO 9001:2015-certified labs and undergo rigorous third-party testing before being approved for distribution.

Available Peptides from Peptide Sciences

This brand offers a comprehensive line of peptides, many of which are used in metabolic, regenerative, nootropic, and cosmetic studies. Their bestsellers include:

  • CJC-1295 with DAC – For growth hormone research
  • GHRP-6 – Stimulates GH release in laboratory models
  • Fragment 176-191 – Studied for its role in fat metabolism
  • BPC-157 – Commonly explored for recovery and tissue repair
  • Melanotan II – A tanning-related peptide used in pigmentation studies
  • Thymosin Beta-4 (TB-500) – Evaluated for its healing and regenerative properties
  • Selank & Semax – Nootropic peptides of interest in cognitive research

Each peptide is provided in sterile, sealed vials, and is labeled strictly for research use only. Researchers value this brand for its traceable manufacturing and transparent sourcing documentation.

Why Choose Peptide Sciences?

Peptide Sciences has earned its reputation by focusing on three core principles: purity, transparency, and compliance. Every peptide comes with access to independent lab testing, providing you with assurance regarding identity, purity level, and absence of contaminants. In addition, all products are synthesized and handled under sterile lab conditions that meet U.S. and international standards.

Some key benefits of using this brand include:

  • Pharmaceutical-grade peptides made in the USA
  • COAs available upon request for most batches
  • Trusted by labs, universities, and institutions worldwide
  • Precise dosing and sterile packaging

Whether you're conducting in vitro, cellular, or preclinical research, Peptide Sciences provides the reliability required for consistent data generation.

Why Buy Peptide Sciences from Research-Peptides.com?

We are proud to offer Peptide Sciences products to our research community. As an authorized distributor, we ensure that every order is fresh, stored under optimal conditions, and delivered securely. Our goal is to support your research with access to dependable, verified peptide compounds from brands you can trust.

Here's why scientists and labs choose us:

  • Fast worldwide shipping with real-time tracking
  • Guaranteed authentic products from the official supply chain
  • Encrypted checkout for secure, hassle-free ordering
  • Knowledgeable support to help match products to your needs

All products are sold strictly for research purposes and are not intended for human or veterinary use. If you require precision and traceability in your peptide research, Peptide Sciences is the brand to trust.

Menu
Account Cart