Peptide Sciences
Peptide Sciences is one of the most recognized names in the peptide research industry. Known for its U.S.-based manufacturing and pharmaceutical-grade quality, this brand is a top choice among academic labs and research professionals. With a wide selection of high-purity compounds, Peptide Sciences ensures consistent results backed by independent testing.
Explore the full range and buy directly from an authorized distributor.
Filters
Filters
Peptides by Brands
Brands
Substances
Shipping Location
Default
Default
Price, low to high
Price, high to low
5-Amino-1MQ 50 mg
- Active Substance: 5-Amino-1-methylquinolinium
- Concentration: 50 mg per capsule
- Pack Size: 60 capsules
- Manufacturer: Peptide Sciences USA
- Brand Name: 5-Amino 1MQ
- Molecular Formula: C10H11N2
- Molecular Weight: 159.21 g/mol
- Synonyms: 5-Amino-1-methylquinolinium, NNMT Inhibitor
Out of Stock
Acetyl Hexapeptide-3 200 mg
- Active Substance: Acetyl hexapeptide-3
- Concentration: 200 mg
- Pack Size: Topical formulation
- Manufacturer: Peptide Sciences USA
- Brand Name: Argireline
- Molecular Formula: C34H60N14O12S
- Molecular Weight: 888.99 g/mol
- Synonyms: Argireline, Acetyl hexapeptide-8
Out of Stock
Adipotide (FTPP) 10mg
- Active Substance: Prohibitin-targeting peptide 1
- Concentration: 10 mg per vial
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: Adipotide
- Molecular Formula: C152H252N44O42
- Molecular Weight: 2611.41 g/mol
- Sequence: CKGGRAKDC-GG-D(KLAKLAK)2
- Synonyms: FTPP, Fat-Targeted Proapoptotic Peptide, Prohibitin-TP01
Out of Stock
AHK (Tripeptide-3) 200 mg
- Active Substance: Copper Tripeptide-3
- Concentration: 200 mg
- Pack Size: Topical formulation
- Manufacturer: Peptide Sciences USA
- Brand Name: AHK
- Molecular Formula: C15H26CuN6O4
- Molecular Weight: 416.94 g/mol
- Sequence: Ala-His-Lys
- Synonyms: AHK-Cu, Copper Tripeptide-3, Alanine-Histidine-Lysine-Copper
Out of Stock
AHK-Cu 200 mg
- Active Substance: Copper Tripeptide-3
- Concentration: 200 mg
- Pack Size: Topical formulation
- Manufacturer: Peptide Sciences USA
- Brand Name: AHK
- Molecular Formula: C15H26CuN6O4
- Molecular Weight: 416.94 g/mol
- Sequence: Ala-His-Lys
- Synonyms: Copper Tripeptide-3, Alanyl-Histidyl-Lysine-Copper, AHK Copper
Out of Stock
AOD9604 6 mg
- Active Substance: Anti-Obesity Drug-9604
- Concentration: 6 mg per vial
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: AOD9604
- Molecular Formula: C78H123N23O23S2
- Molecular Weight: 1815.08 g/mol
- Sequence: Tyr-Leu-Arg-Ile-Val-Gln-Cys-Arg-Ser-Val-Glu-Gly-Ser-Cys-Gly-Phe
- Synonyms: hGH Fragment 177-191, Anti-Obesity Peptide
Out of Stock
ARA-290
- Active Substance: ARA290
- Concentration: 16 mg per vial
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: ARA-290
- Molecular Formula: C51H84N16O21
- Molecular Weight: 1257 Da
- Sequence: Pyroglu-Glu-Gln-Leu-Glu-Arg-Ala-Leu-Asn-Ser-Ser
- Synonyms: Cibinetide, Pyroglutamate Helix B Surface Peptide
Out of Stock
B7-33 6 mg
- Active Substance: Relaxin Receptor 1 Agonist
- Concentration: 6 mg per vial
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: B7-33
- Molecular Formula: C127H212N44O34
- Molecular Weight: ~2951 Da
- Sequence: VIKLSGRELVRAQIAISGMSTWSKRSL
- Synonyms: (B7-33)H2, Single-Chain Relaxin Analog, GTPL9321
Out of Stock
BPC-157 10 mg
- Active Substance: BPC-157 Pentadecapeptide
- Concentration: 10 mg per vial
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: BPC 157
- Molecular Formula: C62H98N16O22
- Molecular Weight: 1419.54 g/mol
- Sequence: Gly-Glu-Pro-Pro-Pro-Gly-Lys-Pro-Ala-Pro-Pro-Ala-Glu-Gly-Lys
- Synonyms: Body Protection Compound-157, Pentadecapeptide BPC
Out of Stock
BPC-157 5 mg
- Active Substance: BPC-157 Pentadecapeptide
- Concentration: 5 mg per vial
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: BPC 157
- Molecular Formula: C62H98N16O22
- Molecular Weight: 1419.54 g/mol
- Sequence: Gly-Glu-Pro-Pro-Pro-Gly-Lys-Pro-Ala-Pro-Pro-Ala-Glu-Gly-Lys
- Synonyms: Body Protection Compound-157, Pentadecapeptide BPC
Out of Stock
BPC-157/TB-500 10 mg Blend
- Active Substance: Thymosin beta 4 / Pentadecapeptide (5 mg BPC-157 + 5 mg TB-500)
- Concentration: 10 mg per vial (5 mg each peptide)
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: Peptide Blend
- Molecular Formula (BPC-157): C62H98N16O22
- Molecular Weight (BPC-157): 1419.54 g/mol
- Sequence (BPC-157): Gly-Glu-Pro-Pro-Pro-Gly-Lys-Pro-Ala-Pro-Pro-Ala-Glu-Gly-Lys
- Molecular Formula (TB-500): C38H68N10O14
- Molecular Weight (TB-500): 889.01 g/mol
- Sequence (TB-500): Ac-LKKTETQ
- Synonyms: BPC-157 (Body Protection Compound-157), TB-500 (Thymosin Beta-4 fragment)
Out of Stock
BPC-157/TB-500 20 mg Blend
- Active Substance: Thymosin beta 4 / Pentadecapeptide (10 mg BPC-157 + 10 mg TB-500)
- Concentration: 20 mg per vial (10 mg each peptide)
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Molecular Formula (BPC-157): C62H98N16O22
- Molecular Weight (BPC-157): 1419.54 g/mol
- Sequence (BPC-157): Gly-Glu-Pro-Pro-Pro-Gly-Lys-Pro-Ala-Pro-Pro-Ala-Glu-Gly-Lys
- Molecular Formula (TB-500): C38H68N10O14
- Molecular Weight (TB-500): 889.01 g/mol
- Sequence (TB-500): Ac-LKKTETQ
- Synonyms: BPC-157 (Body Protection Compound-157), TB-500 (Thymosin Beta-4 fragment)
Out of Stock
BPC-157/TB-500/GHK-Cu 30 mg
- Active Substance: Thymosin beta 4 / Pentadecapeptide / GHK-Cu (10 mg BPC-157 + 10 mg TB-500 + 10 mg GHK-Cu)
- Concentration: 30 mg per vial (10 mg each peptide)
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: Peptide Blend
- Molecular Formula (BPC-157): C62H98N16O22
- Molecular Weight (BPC-157): 1419.54 g/mol
- Sequence (BPC-157): Gly-Glu-Pro-Pro-Pro-Gly-Lys-Pro-Ala-Pro-Pro-Ala-Glu-Gly-Lys
- Molecular Formula (TB-500): C38H68N10O14
- Molecular Weight (TB-500): 889.01 g/mol
- Sequence (TB-500): Ac-LKKTETQ
- Molecular Formula (GHK-Cu): C14H24CuN6O4
- Molecular Weight (GHK-Cu): 340.87 g/mol (excluding copper)
- Sequence (GHK-Cu): Glycyl-Histidyl-Lysine
- Synonyms: BPC-157 (Body Protection Compound-157), TB-500 (Thymosin Beta-4 fragment), GHK-Cu (Copper Tripeptide-1)
Out of Stock
Bronchogen 20 mg
- Active Substance: Bronchogen
- Concentration: 20 mg per vial
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: Bronchogen
- Molecular Formula: C18H30N4O9
- Molecular Weight: 446.45 g/mol
- Sequence: Ala-Glu-Asp-Leu
- Synonyms: AEDL, Bronchial Peptide Bioregulator
Out of Stock
Cagrilintide 10 mg
- Active Substance: Cagrilintide
- Concentration: 10 mg per vial
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: Cagrilintide
- Molecular Formula: C194H312N54O59S2.xC2H4O2
- Molecular Weight: 4409.01 g/mol
- Sequence: XKCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP
- Synonyms: AM833, AT42613
Out of Stock
Cardiogen 20 mg
- Active Substance: Cardiogen
- Concentration: 20 mg per vial
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: Cardiogen
- Molecular Formula: C18H31N7O9
- Molecular Weight: 489.5 g/mol
- Sequence: Ala-Glu-Asp-Arg
Out of Stock
Cartalax 20 mg
- Active Substance: Cartalax
- Concentration: 20 mg per vial
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: Cartalax
- Molecular Formula: C12H19N3O8
- Molecular Weight: 333.29 g/mol
- Sequence: Ala-Glu-Asp
- Synonyms: AED, T-31, SCHEMBL5324601
Out of Stock
Chonluten 20 mg
- Active Substance: Chonluten
- Concentration: 20 mg per vial
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: Chonluten
- Molecular Formula: C11H17N3O8
- Molecular Weight: 319.27 g/mol
- Sequence: Glu-Asp-Gly
- Synonyms: Tripeptide T-34, EDG, AC-7
Out of Stock
CJC-1295 (No DAC) / Ipamorelin 10 mg
- Active Substance: Duo-Blend CJC-1295 No DAC and Ipamorelin (5 mg each)
- Concentration: 10 mg per vial (5 mg CJC-1295 No DAC + 5 mg Ipamorelin)
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: Peptide Blend
- Molecular Formula (CJC-1295 No DAC): C152H252N44O42
- Molecular Weight (CJC-1295 No DAC): 3367.97 g/mol
- Sequence (CJC-1295 No DAC): H-Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-Ser-Arg-NH2
- Molecular Formula (Ipamorelin): C38H49N9O5
- Molecular Weight (Ipamorelin): 711.85 g/mol
- Sequence (Ipamorelin): Aib-His-D-2-Nal-D-Phe-Lys-NH2
- Synonyms: CJC-1295 No DAC (Modified GRF 1-29, Sermorelin analog), Ipamorelin (GHRP, Ghrelin mimetic)
Out of Stock
CJC-1295 / GHRP-6 10 mg
- Product Title: CJC-1295 / GHRP-2 10 mg
- Active Substance: Tetrasubstituted 30-Amino Acid Peptide Hormone / Growth Hormone-Releasing Peptide 2 (5 mg CJC-1295 No DAC + 5 mg GHRP-2)
- Concentration: 10 mg per vial (5 mg each peptide)
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: Peptide Blend
- Molecular Formula (CJC-1295 No DAC): C152H252N44O42
- Molecular Weight (CJC-1295 No DAC): 3367.97 g/mol
- Sequence (CJC-1295 No DAC): H-Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-Ser-Arg-NH2
- Molecular Formula (GHRP-2): C45H55N9O6
- Molecular Weight (GHRP-2): 818.0 g/mol
- Sequence (GHRP-2): D-Ala-D-2-Nal-Ala-Trp-D-Phe-Lys-NH2
- Synonyms: CJC-1295 No DAC (Modified GRF 1-29, Sermorelin analog), GHRP-2 (Pralmorelin, Growth Hormone-Releasing Peptide-2)
Out of Stock