Fat Loss Peptides

Explore our selection of fat loss peptides, scientifically formulated for studies on metabolism, body composition, and lipolysis. These compounds are frequently used in research investigating adipose tissue breakdown and growth hormone-related fat metabolism. Featuring trusted options like AOD-9604, Fragment 176-191, and Tesamorelin, this category supports advanced weight regulation studies.
Shop high-purity peptides and accelerate your fat loss research today.

Showing 36 of 36 products
Image
SKU
Product
Rating
Price
Only 23 hours left with this price
-30% OFF
Generic Peptides
  • Active Substance: 5-Amino-1-methylquinolinium
  • Concentration: 10 mg
  • Pack Size: vial
  • Manufacturer: Generic Peptides
  • Brand Name: 5-Amino 1MQ
  • Molecular Formula: C10H11N2+
  • Molecular Weight: 159.21 g/mol
  • Synonyms: 5-Amino-1-methylquinolinium, NNMT Inhibitor
Dragon Pharma
  • Active Substance: Cagrilintide
  • Concentration: 10 mg/ml per vial
  • Pack Size: Lyophilized injectable vial
  • Manufacturer: Dragon Pharma
  • Brand Name: Cagrilintide
  • Molecular Formula: C135H224N42O40S
  • Molecular Weight: ~3400 g/mol
  • Synonyms: AM833, Amylin Receptor Agonist, Long-Acting Amylin Analog
Dragon Pharma
  • Active Substance: GW 501516 (Cardarine)
  • Concentration: 20 mg per tablet
  • Pack Size: 100 tablets
  • Manufacturer: Dragon Pharma
  • Brand Name: Cardarine
  • Molecular Formula: C21H18F3NO3S2
  • Molecular Weight: 453.5 g/mol
  • Synonyms: Cardarine, GW1516, Endurobol
Dragon Pharma
  • Active Substance: L-Carnitine
  • Concentration: 500 mg/ml
  • Pack Size: 1 x vial (injectable solution)
  • Manufacturer: Dragon Pharma
  • Brand Name: L-Carnitine
  • Molecular Formula: C7H15NO3
  • Molecular Weight: 161.2 g/mol
  • Synonyms: Levocarnitine, L-3-hydroxy-4-N-trimethylaminobutyric acid
Dragon Pharma
  • Active Substance: Mazdutide
  • Concentration: 10 mg/ml
  • Pack Size: 1 x vial (injectable solution)
  • Manufacturer: Dragon Pharma
  • Brand Name: Mazdutide
  • Molecular Formula: C219H358N64O68
  • Molecular Weight: Approx. 5100 g/mol
  • Synonyms: Oxyntomodulin analog, GLP-1/GCGR dual agonist
Dragon Pharma
  • Active Substance: MOTS-c
  • Concentration: 10 mg per vial
  • Pack Size: 1 vial (lyophilized powder)
  • Manufacturer: Dragon Pharma
  • Brand Name: MOTS-c
  • Molecular Formula: C49H75N15O10
  • Molecular Weight: 1020.21 g/mol
  • Synonyms: Mitochondrial Open Reading Frame of the 12S rRNA-c, MDP-1
Dragon Pharma
  • Active Substance: Survodutide
  • Concentration: 10 mg/ml
  • Pack Size: Single vial
  • Manufacturer: Dragon Pharma
  • Brand Name: Survodutide
  • Molecular Formula: C187H293N51O57
  • Molecular Weight: Approx. 4200 g/mol
  • Synonyms: HM15211, Dual GLP-1/Glucagon Agonist, GLP-GCG peptide
Dragon Pharma
  • Active Substance: Tesamorelin
  • Concentration: 5 mg per vial
  • Pack Size: Lyophilized injectable vial
  • Manufacturer: Dragon Pharma
  • Brand Name: Tesamorelin
  • Molecular Formula: C221H366N72O67S
  • Molecular Weight: 5135.91 g/mol
  • Synonyms: Egrifta, GHRH(1–44) analog, GHRH modulator
Dragon Pharma
  • Active Substance: Tirzepatide
  • Concentration: 5 mg per vial
  • Pack Size: Lyophilized injectable vial
  • Manufacturer: Dragon Pharma
  • Brand Name: Tirze-Pep
  • Molecular Formula: C225H348N56O64
  • Molecular Weight: 4813.5 g/mol
  • Synonyms: LY3298176, GLP-1/GIP dual agonist
Peptide Sciences USA

  • Active Substance: 5-Amino-1-methylquinolinium
  • Concentration: 50 mg per capsule
  • Pack Size: 60 capsules
  • Manufacturer: Peptide Sciences USA
  • Brand Name: 5-Amino 1MQ
  • Molecular Formula: C10H11N2
  • Molecular Weight: 159.21 g/mol
  • Synonyms: 5-Amino-1-methylquinolinium, NNMT Inhibitor
Peptide Sciences USA
  • Active Substance: Prohibitin-targeting peptide 1
  • Concentration: 10 mg per vial
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: Adipotide
  • Molecular Formula: C152H252N44O42
  • Molecular Weight: 2611.41 g/mol
  • Sequence: CKGGRAKDC-GG-D(KLAKLAK)2
  • Synonyms: FTPP, Fat-Targeted Proapoptotic Peptide, Prohibitin-TP01
Peptide Sciences USA
  • Active Substance: Anti-Obesity Drug-9604
  • Concentration: 6 mg per vial
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: AOD9604
  • Molecular Formula: C78H123N23O23S2
  • Molecular Weight: 1815.08 g/mol
  • Sequence: Tyr-Leu-Arg-Ile-Val-Gln-Cys-Arg-Ser-Val-Glu-Gly-Ser-Cys-Gly-Phe
  • Synonyms: hGH Fragment 177-191, Anti-Obesity Peptide
Peptide Sciences USA
  • Active Substance: Cagrilintide
  • Concentration: 10 mg per vial
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: Cagrilintide
  • Molecular Formula: C194H312N54O59S2.xC2H4O2
  • Molecular Weight: 4409.01 g/mol
  • Sequence: XKCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP
  • Synonyms: AM833, AT42613
Peptide Sciences USA
  • Active Substance: Modified GRF (CJC-1295 No DAC) and Ipamorelin (5 mg each)
  • Concentration: 10 mg per vial (5 mg Mod GRF + 5 mg Ipamorelin)
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: Peptide Blend
  • Molecular Formula (Mod GRF): C152H252N44O42
  • Molecular Weight (Mod GRF): 3367.97 g/mol
  • Sequence (Mod GRF): H-Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-Ser-Arg-NH2
  • Molecular Formula (Ipamorelin): C38H49N9O5
  • Molecular Weight (Ipamorelin): 711.85 g/mol
  • Sequence (Ipamorelin): Aib-His-D-2-Nal-D-Phe-Lys-NH2
  • Synonyms: Mod GRF (CJC-1295 No DAC, Sermorelin analog), Ipamorelin (GHRP, Ghrelin mimetic)
Peptide Sciences USA
  • Active Substance: Sermorelin (GHRH 1-29) and GHRP-6 (5 mg each)
  • Concentration: 10 mg per vial (5 mg Sermorelin + 5 mg GHRP-6)
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: Peptide Blend
  • Molecular Formula (Sermorelin): C149H246N44O42S
  • Molecular Weight (Sermorelin): 3357.93 g/mol
  • Sequence (Sermorelin): Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-NH2
  • Molecular Formula (GHRP-6): C46H56N12O6
  • Molecular Weight (GHRP-6): 873.01 g/mol
  • Sequence (GHRP-6): His-D-Trp-Ala-Trp-D-Phe-Lys-NH2
  • Synonyms: Sermorelin (GHRH 1-29, Mod GRF), GHRP-6 (Growth Hormone-Releasing Hexapeptide)
Peptide Sciences USA
  • Active Substance: Tesamorelin (6 mg) and Ipamorelin (2 mg)
  • Concentration: 8 mg per vial (6 mg Tesamorelin + 2 mg Ipamorelin)
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: Peptide Blend
  • Molecular Formula (Tesamorelin): C221H366N72O67S
  • Molecular Weight (Tesamorelin): 5135.86 g/mol
  • Sequence (Tesamorelin): Unk-Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-Gln-Gln-Gly-Glu-Ser-Asn-Gln-Glu-Arg-Gly-Ala-Arg-Ala-Arg-Leu-NH2
  • Molecular Formula (Ipamorelin): C38H49N9O5
  • Molecular Weight (Ipamorelin): 711.85 g/mol
  • Sequence (Ipamorelin): Aib-His-D-2-Nal-D-Phe-Lys-NH2
  • Synonyms: Tesamorelin (Egrifta, TH9507), Ipamorelin (GHRP, Ghrelin mimetic)
Peptide Sciences USA
  • Active Substance: HGH Fragment 176-191 (6 mg), Modified GRF (CJC-1295 No DAC, 3 mg), Ipamorelin (3 mg)
  • Concentration: 12 mg per vial (6 mg HGH Fragment 176-191 + 3 mg Modified GRF + 3 mg Ipamorelin)
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: Peptide Blend
  • Molecular Formula (HGH Fragment 176-191): C78H125N24O24S2
  • Molecular Weight (HGH Fragment 176-191): 1817.12 g/mol
  • Sequence (HGH Fragment 176-191): Tyr-Leu-Arg-Ile-Val-Gln-Cys-Arg-Ser-Val-Glu-Gly-Ser-Cys-Gly-Phe
  • Molecular Formula (Modified GRF): C152H252N44O42
  • Molecular Weight (Modified GRF): 3367.97 g/mol
  • Sequence (Modified GRF): H-Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-Ser-Arg-NH2
  • Molecular Formula (Ipamorelin): C38H49N9O5
  • Molecular Weight (Ipamorelin): 711.85 g/mol
  • Sequence (Ipamorelin): Aib-His-D-2-Nal-D-Phe-Lys-NH2
  • Synonyms: HGH Fragment 176-191 (AOD9604), Modified GRF (CJC-1295 No DAC), Ipamorelin (GHRP, Ghrelin mimetic)
Peptide Sciences USA
  • Active Substance: HGH Fragment 176-191 (6 mg), CJC1295 No DAC (3 mg), Ipamorelin (3 mg)
  • Concentration: 12 mg per vial (6 mg HGH Fragment 176-191 + 3 mg CJC1295 + 3 mg Ipamorelin)
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: Peptide Blend
  • Molecular Formula (HGH Fragment 176-191): C78H125N24O24S2
  • Molecular Weight (HGH Fragment 176-191): 1817.12 g/mol
  • Sequence (HGH Fragment 176-191): Tyr-Leu-Arg-Ile-Val-Gln-Cys-Arg-Ser-Val-Glu-Gly-Ser-Cys-Gly-Phe
  • Molecular Formula (CJC1295 No DAC): C152H252N44O42
  • Molecular Weight (CJC1295 No DAC): 3367.97 g/mol
  • Sequence (CJC1295 No DAC): H-Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-Ser-Arg-NH2
  • Molecular Formula (Ipamorelin): C38H49N9O5
  • Molecular Weight (Ipamorelin): 711.85 g/mol
  • Sequence (Ipamorelin): Aib-His-D-2-Nal-D-Phe-Lys-NH2
  • Synonyms: HGH Fragment 176-191 (AOD9604), CJC1295 No DAC (Mod GRF), Ipamorelin (GHRP, Ghrelin mimetic)
Peptide Sciences USA
  • Active Substance: Growth Hormone-Releasing Peptide 2 (GHRP-2)
  • Concentration: 10 mg per vial
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: GHRP-2
  • Molecular Formula: C45H55N9O6
  • Molecular Weight: 818.0 g/mol
  • Sequence: D-Ala-D-2-Nal-Ala-Trp-D-Phe-Lys-NH2
  • Synonyms: Pralmorelin, Growth Hormone Secretagogue
Peptide Sciences USA
  • Active Substance: Growth Hormone-Releasing Peptide 2 (GHRP-2)
  • Concentration: 5 mg per vial
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: GHRP-2
  • Molecular Formula: C45H55N9O6
  • Molecular Weight: 818.0 g/mol
  • Sequence: D-Ala-D-2-Nal-Ala-Trp-D-Phe-Lys-NH2
  • Synonyms: Pralmorelin, Growth Hormone Secretagogue
Peptide Sciences USA
  • Active Substance: Growth Hormone-Releasing Peptide 6 (GHRP-6)
  • Concentration: 10 mg per vial
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: GHRP-6
  • Molecular Formula: C46H56N12O6
  • Molecular Weight: 873.01 g/mol
  • Sequence: His-D-Trp-Ala-Trp-D-Phe-Lys-NH2
  • Synonyms: Growth Hormone Secretagogue, GHRP-6
Peptide Sciences USA
  • Active Substance: Hexarelin
  • Concentration: 2 mg per vial
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: Hexarelin
  • Molecular Formula: C47H58N12O6
  • Molecular Weight: 887.04 g/mol
  • Sequence: His-D-2-Me-Trp-Ala-Trp-D-Phe-Lys-NH2
  • Synonyms: Growth Hormone Secretagogue, Examorelin
Peptide Sciences USA
  • Active Substance: Growth Hormone Peptide Fragment 176-191
  • Concentration: 6 mg per vial
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: Fragment HGH
  • Molecular Formula: C78H125N20O23S
  • Molecular Weight: ~1817 g/mol
  • Sequence: Tyr-Leu-Arg-Ile-Val-Gln-Cys-Arg-Ser-Val-Glu-Gly-Ser-Cys-Gly-Phe
  • Synonyms: hGH Fragment, AOD9604
Peptide Sciences USA
  • Active Substance: Insulin-like Growth Factor 1, Long R3
  • Concentration: 1 mg per vial
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: IGF-1 LR3
  • Molecular Formula: C400H625N111O115S9
  • Molecular Weight: 9117.5 g/mol
  • Sequence: MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
  • Synonyms: Long R3 IGF-1, LR3-IGF-1
Peptide Sciences USA
  • Active Substance: Ipamorelin
  • Concentration: 10 mg per vial
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: Ipamorelin
  • Molecular Formula: C38H49N9O5
  • Molecular Weight: 711.85 g/mol
  • Sequence: Aib-His-D-2-Nal-D-Phe-Lys-NH2
  • Synonyms: Growth Hormone Secretagogue, GHRP
Peptide Sciences USA
  • Active Substance: Ipamorelin
  • Concentration: 5 mg per vial
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: Ipamorelin
  • Molecular Formula: C38H49N9O5
  • Molecular Weight: 711.85 g/mol
  • Sequence: Aib-His-D-2-Nal-D-Phe-Lys-NH2
  • Synonyms: Growth Hormone Secretagogue, GHRP
Peptide Sciences USA
  • Active Substance: Ipamorelin
  • Concentration: 2 mg per vial
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: Ipamorelin
  • Molecular Formula: C38H49N9O5
  • Molecular Weight: 711.85 g/mol
  • Sequence: Aib-His-D-2-Nal-D-Phe-Lys-NH2
  • Synonyms: Growth Hormone Secretagogue, GHRP
Peptide Sciences USA
  • Active Substances: 5-amino-1MQ (50 mg/capsule), NMN (50 mg/capsule), JBSNF-000088 (5 mg/capsule)
  • Concentration: 105 mg per capsule
  • Pack Size: 60 capsules
  • Manufacturer: Peptide Sciences USA
  • Brand Name: Peptide Blend
  • Molecular Formulas: 5-amino-1MQ (C10H11N2), NMN (C11H15N2O8P), JBSNF-000088 (C7H8N2O)
  • Molecular Weights: 5-amino-1MQ (159.21 g/mol), NMN (334.22 g/mol), JBSNF-000088 (136.15 g/mol)
  • Synonyms: 5-amino-1-methylquinolinium, Nicotinamide Mononucleotide, 6-Methoxynicotinamide
Peptide Sciences USA
  • Active Substance: MOTS-c (Mitochondrial-Derived Peptide)
  • Concentration: 10 mg per vial
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: MOTS-c
  • Molecular Formula: C74H115N23O23S2
  • Molecular Weight: 1718.97 g/mol
  • Sequence: Met-Arg-Trp-Gln-Glu-Met-Gly-Tyr-Ile-Phe-Tyr-Pro-Arg-Lys-Leu-Arg
  • Synonyms: Mitochondrial ORF of the 12S rRNA-c, MDP
Peptide Sciences USA
  • Active Substance: MOTS-c (Mitochondrial-Derived Peptide)
  • Concentration: 5 mg per vial
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: MOTS-c
  • Molecular Formula: C74H115N23O23S2
  • Molecular Weight: 1718.97 g/mol
  • Sequence: Met-Arg-Trp-Gln-Glu-Met-Gly-Tyr-Ile-Phe-Tyr-Pro-Arg-Lys-Leu-Arg
  • Synonyms: Mitochondrial ORF of the 12S rRNA-c, MDP
Peptide Sciences USA
  • Active Substance: SLU-PP-332 (Pan-ERR Agonist)
  • Concentration: 1000 mcg per capsule
  • Pack Size: 30 capsules (30,000 mcg total)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: SLU-PP-332
  • Molecular Formula: Not fully disclosed (medium-length peptide)
  • Molecular Weight: 290.32 g/mol
  • Sequence: Proprietary (10–30 amino acids)
  • Synonyms: SLU-PP-332, ERR Agonist, Exercise Mimetic
Peptide Sciences USA
  • Active Substances: Tesamorelin, CJC-1295 (Mod GRF 1-29, no DAC), Ipamorelin
  • Concentration: 12 mg per vial (6 mg Tesamorelin, 3 mg CJC-1295, 3 mg Ipamorelin)
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: Peptide Blend
  • Synonyms: Tesamorelin / CJC-1295 / Ipamorelin Blend, GHRH/GHRP Blend
Peptide Sciences USA
  • Active Substance: Tesamorelin
  • Concentration: 2 mg per vial
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: Tesamorelin
  • Molecular Formula: C221H366N72O67S
  • Molecular Weight: 5135.89 g/mol
  • Sequence: H-His-D-Trp-Ala-Trp-D-Phe-Lys-Thr-Phe-Thr-Ser-Tyr-Ser-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-Ser-Arg-NH2
  • Synonyms: Egrifta, Growth Hormone-Releasing Factor (GHRF) Analog
Peptide Sciences USA
  • Active Substance: Tesamorelin (GHRH Analog)
  • Concentration: 5 mg per vial
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: Tesamorelin
  • Molecular Formula: C221H366N72O67S
  • Molecular Weight: 5135.9 g/mol
  • Sequence: 44 amino acids (proprietary GHRH analog)
  • Synonyms: Tesamorelin Acetate, Egrifta, TH9507
Peptide Sciences USA
  • Active Substance: Tesofensine (Triple Monoamine Reuptake Inhibitor)
  • Concentration: 500 mcg per capsule
  • Pack Size: 30 capsules (15,000 mcg total)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: Tesofensine
  • Molecular Formula: C17H23Cl2NO
  • Molecular Weight: 328.28 g/mol
  • Sequence: Not a peptide (N-[3-(3,4-dichlorophenyl)-1-methylpropyl]-N-methylpropan-1-amine)
  • Synonyms: NS2330, TE, Tesofensine Acetate
Peptide Sciences USA
  • Concentration: 5 mg per vial
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: Tirzepatide
  • Molecular Formula: C225H348N56O67
  • Molecular Weight: 4813.5 g/mol
  • Synonyms: LY3298176, Dual Incretin Agonist Peptide

Peptides for Weight Loss

Fat loss peptides are a class of research compounds studied for their ability to influence metabolic rate, fat mobilization, and adipocyte function. Many of these peptides are derived from growth hormone fragments or secretagogues and are believed to interact with key hormonal pathways that regulate body weight and energy storage. These compounds offer unique mechanisms for exploring fat loss without affecting lean muscle mass.

Common Peptides Used in Fat Loss Research

Our fat loss peptide selection includes several well-documented compounds frequently used in academic and clinical settings:

  • AOD-9604 – A modified fragment of human growth hormone that targets fat metabolism
  • Fragment 176-191 – A GH fragment peptide known to enhance lipolysis in fat tissues
  • Tesamorelin – A GHRH analog studied for fat redistribution and visceral adiposity
  • Ipamorelin + CJC-1295 – Synergistic peptide pair used in fat-burning and GH pulse research
  • 5-Amino-1MQ – Explored for its effects on NAD+ pathways and cellular metabolism

Each peptide is manufactured under sterile conditions and is clearly labeled for research use only. Vial-based and oral/capsule formats may be available depending on the brand.

Benefits of Fat Loss Peptides in Research

Researchers turn to these peptides to explore safe, non-stimulant approaches to fat reduction. Unlike thermogenics or chemical fat burners, fat loss peptides typically target hormonal signaling and adipose-specific pathways. This makes them highly valuable in metabolic and endocrinological studies.

Primary research benefits include:

  • Targeted fat burning with minimal impact on lean mass
  • Improved understanding of growth hormone-dependent fat metabolism
  • Potential synergy when stacked with other research compounds
  • Flexible application in obesity, fitness, or metabolic models

These peptides are also useful in long-term, progressive dosing studies due to their relatively mild profile.

Why Buy Fat Loss Peptides from Research-Peptides.com?

At BuyPeptides.net, we offer fat loss peptides from leading peptide labs including Peptide Sciences, Deus Medical, and Dragon Peptides. Every compound is sourced from GMP-compliant facilities and verified for purity, stability, and sterility.

By shopping with us, you benefit from:

  • Verified quality with batch-level transparency
  • Fast international shipping with live tracking
  • Secure checkout and protected customer data
  • Helpful product support if you need compound guidance

All peptides are intended strictly for research purposes and are not approved for human or veterinary use. For clean, targeted fat loss studies, this category offers industry-trusted compounds ready to support your research goals.