Fat Loss Peptides
Explore our selection of fat loss peptides, scientifically formulated for studies on metabolism, body composition, and lipolysis. These compounds are frequently used in research investigating adipose tissue breakdown and growth hormone-related fat metabolism. Featuring trusted options like AOD-9604, Fragment 176-191, and Tesamorelin, this category supports advanced weight regulation studies.
Shop high-purity peptides and accelerate your fat loss research today.
Filters
Filters
Peptides By Research Purpose
Filter By Price
$
$
Brands
Substances
Manufacturers
Shipping Location
Default
Default
Price, low to high
Price, high to low
Cagrilintide
$100.00
$100.00
- Active Substance: Cagrilintide
- Concentration: 10 mg/ml per vial
- Pack Size: Lyophilized injectable vial
- Manufacturer: Dragon Pharma
- Brand Name: Cagrilintide
- Molecular Formula: C135H224N42O40S
- Molecular Weight: ~3400 g/mol
- Synonyms: AM833, Amylin Receptor Agonist, Long-Acting Amylin Analog
GW 501516
$96.00
$96.00
- Active Substance: GW 501516 (Cardarine)
- Concentration: 20 mg per tablet
- Pack Size: 100 tablets
- Manufacturer: Dragon Pharma
- Brand Name: Cardarine
- Molecular Formula: C21H18F3NO3S2
- Molecular Weight: 453.5 g/mol
- Synonyms: Cardarine, GW1516, Endurobol
L-Carnitine 500
$70.00
$70.00
- Active Substance: L-Carnitine
- Concentration: 500 mg/ml
- Pack Size: 1 x vial (injectable solution)
- Manufacturer: Dragon Pharma
- Brand Name: L-Carnitine
- Molecular Formula: C7H15NO3
- Molecular Weight: 161.2 g/mol
- Synonyms: Levocarnitine, L-3-hydroxy-4-N-trimethylaminobutyric acid
Mazdutide
$100.00
$100.00
- Active Substance: Mazdutide
- Concentration: 10 mg/ml
- Pack Size: 1 x vial (injectable solution)
- Manufacturer: Dragon Pharma
- Brand Name: Mazdutide
- Molecular Formula: C219H358N64O68
- Molecular Weight: Approx. 5100 g/mol
- Synonyms: Oxyntomodulin analog, GLP-1/GCGR dual agonist
MOTS-c 10mg
$70.00
$70.00
- Active Substance: MOTS-c
- Concentration: 10 mg per vial
- Pack Size: 1 vial (lyophilized powder)
- Manufacturer: Dragon Pharma
- Brand Name: MOTS-c
- Molecular Formula: C49H75N15O10
- Molecular Weight: 1020.21 g/mol
- Synonyms: Mitochondrial Open Reading Frame of the 12S rRNA-c, MDP-1
5-Amino 1MQ
$30.00
$30.00
- Active Substance: 5-Amino-1-methylquinolinium
- Concentration: 10 mg
- Pack Size: vial
- Manufacturer: Generic Peptides
- Brand Name: 5-Amino 1MQ
- Molecular Formula: C10H11N2+
- Molecular Weight: 159.21 g/mol
- Synonyms: 5-Amino-1-methylquinolinium, NNMT Inhibitor
Survodutide
$110.00
$110.00
- Active Substance: Survodutide
- Concentration: 10 mg/ml
- Pack Size: Single vial
- Manufacturer: Dragon Pharma
- Brand Name: Survodutide
- Molecular Formula: C187H293N51O57
- Molecular Weight: Approx. 4200 g/mol
- Synonyms: HM15211, Dual GLP-1/Glucagon Agonist, GLP-GCG peptide
Tesamorelin
$80.00
$80.00
- Active Substance: Tesamorelin
- Concentration: 5 mg per vial
- Pack Size: Lyophilized injectable vial
- Manufacturer: Dragon Pharma
- Brand Name: Tesamorelin
- Molecular Formula: C221H366N72O67S
- Molecular Weight: 5135.91 g/mol
- Synonyms: Egrifta, GHRH(1–44) analog, GHRH modulator
Tirze-Pep 5mg
$99.00
$99.00
- Active Substance: Tirzepatide
- Concentration: 5 mg per vial
- Pack Size: Lyophilized injectable vial
- Manufacturer: Dragon Pharma
- Brand Name: Tirze-Pep
- Molecular Formula: C225H348N56O64
- Molecular Weight: 4813.5 g/mol
- Synonyms: LY3298176, GLP-1/GIP dual agonist
5-Amino-1MQ 50 mg
- Active Substance: 5-Amino-1-methylquinolinium
- Concentration: 50 mg per capsule
- Pack Size: 60 capsules
- Manufacturer: Peptide Sciences USA
- Brand Name: 5-Amino 1MQ
- Molecular Formula: C10H11N2
- Molecular Weight: 159.21 g/mol
- Synonyms: 5-Amino-1-methylquinolinium, NNMT Inhibitor
Out of Stock
Adipotide (FTPP) 10mg
- Active Substance: Prohibitin-targeting peptide 1
- Concentration: 10 mg per vial
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: Adipotide
- Molecular Formula: C152H252N44O42
- Molecular Weight: 2611.41 g/mol
- Sequence: CKGGRAKDC-GG-D(KLAKLAK)2
- Synonyms: FTPP, Fat-Targeted Proapoptotic Peptide, Prohibitin-TP01
Out of Stock
AOD9604 6 mg
- Active Substance: Anti-Obesity Drug-9604
- Concentration: 6 mg per vial
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: AOD9604
- Molecular Formula: C78H123N23O23S2
- Molecular Weight: 1815.08 g/mol
- Sequence: Tyr-Leu-Arg-Ile-Val-Gln-Cys-Arg-Ser-Val-Glu-Gly-Ser-Cys-Gly-Phe
- Synonyms: hGH Fragment 177-191, Anti-Obesity Peptide
Out of Stock
Cagrilintide 10 mg
- Active Substance: Cagrilintide
- Concentration: 10 mg per vial
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: Cagrilintide
- Molecular Formula: C194H312N54O59S2.xC2H4O2
- Molecular Weight: 4409.01 g/mol
- Sequence: XKCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP
- Synonyms: AM833, AT42613
Out of Stock
Duo-Blend Mod GRF / Ipamorelin 10 mg
- Active Substance: Modified GRF (CJC-1295 No DAC) and Ipamorelin (5 mg each)
- Concentration: 10 mg per vial (5 mg Mod GRF + 5 mg Ipamorelin)
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: Peptide Blend
- Molecular Formula (Mod GRF): C152H252N44O42
- Molecular Weight (Mod GRF): 3367.97 g/mol
- Sequence (Mod GRF): H-Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-Ser-Arg-NH2
- Molecular Formula (Ipamorelin): C38H49N9O5
- Molecular Weight (Ipamorelin): 711.85 g/mol
- Sequence (Ipamorelin): Aib-His-D-2-Nal-D-Phe-Lys-NH2
- Synonyms: Mod GRF (CJC-1295 No DAC, Sermorelin analog), Ipamorelin (GHRP, Ghrelin mimetic)
Out of Stock
Duo-Blend Sermorelin / GHRP-6 10 mg
- Active Substance: Sermorelin (GHRH 1-29) and GHRP-6 (5 mg each)
- Concentration: 10 mg per vial (5 mg Sermorelin + 5 mg GHRP-6)
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: Peptide Blend
- Molecular Formula (Sermorelin): C149H246N44O42S
- Molecular Weight (Sermorelin): 3357.93 g/mol
- Sequence (Sermorelin): Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-NH2
- Molecular Formula (GHRP-6): C46H56N12O6
- Molecular Weight (GHRP-6): 873.01 g/mol
- Sequence (GHRP-6): His-D-Trp-Ala-Trp-D-Phe-Lys-NH2
- Synonyms: Sermorelin (GHRH 1-29, Mod GRF), GHRP-6 (Growth Hormone-Releasing Hexapeptide)
Out of Stock
Duo-Blend Tesamorelin / Ipamorelin 8 mg
- Active Substance: Tesamorelin (6 mg) and Ipamorelin (2 mg)
- Concentration: 8 mg per vial (6 mg Tesamorelin + 2 mg Ipamorelin)
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: Peptide Blend
- Molecular Formula (Tesamorelin): C221H366N72O67S
- Molecular Weight (Tesamorelin): 5135.86 g/mol
- Sequence (Tesamorelin): Unk-Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-Gln-Gln-Gly-Glu-Ser-Asn-Gln-Glu-Arg-Gly-Ala-Arg-Ala-Arg-Leu-NH2
- Molecular Formula (Ipamorelin): C38H49N9O5
- Molecular Weight (Ipamorelin): 711.85 g/mol
- Sequence (Ipamorelin): Aib-His-D-2-Nal-D-Phe-Lys-NH2
- Synonyms: Tesamorelin (Egrifta, TH9507), Ipamorelin (GHRP, Ghrelin mimetic)
Out of Stock
Fragment / Modified GRF / Ipamorelin 12 mg
- Active Substance: HGH Fragment 176-191 (6 mg), Modified GRF (CJC-1295 No DAC, 3 mg), Ipamorelin (3 mg)
- Concentration: 12 mg per vial (6 mg HGH Fragment 176-191 + 3 mg Modified GRF + 3 mg Ipamorelin)
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: Peptide Blend
- Molecular Formula (HGH Fragment 176-191): C78H125N24O24S2
- Molecular Weight (HGH Fragment 176-191): 1817.12 g/mol
- Sequence (HGH Fragment 176-191): Tyr-Leu-Arg-Ile-Val-Gln-Cys-Arg-Ser-Val-Glu-Gly-Ser-Cys-Gly-Phe
- Molecular Formula (Modified GRF): C152H252N44O42
- Molecular Weight (Modified GRF): 3367.97 g/mol
- Sequence (Modified GRF): H-Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-Ser-Arg-NH2
- Molecular Formula (Ipamorelin): C38H49N9O5
- Molecular Weight (Ipamorelin): 711.85 g/mol
- Sequence (Ipamorelin): Aib-His-D-2-Nal-D-Phe-Lys-NH2
- Synonyms: HGH Fragment 176-191 (AOD9604), Modified GRF (CJC-1295 No DAC), Ipamorelin (GHRP, Ghrelin mimetic)
Out of Stock
Fragment / CJC1295 / Ipamorelin 12 mg
- Active Substance: HGH Fragment 176-191 (6 mg), CJC1295 No DAC (3 mg), Ipamorelin (3 mg)
- Concentration: 12 mg per vial (6 mg HGH Fragment 176-191 + 3 mg CJC1295 + 3 mg Ipamorelin)
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: Peptide Blend
- Molecular Formula (HGH Fragment 176-191): C78H125N24O24S2
- Molecular Weight (HGH Fragment 176-191): 1817.12 g/mol
- Sequence (HGH Fragment 176-191): Tyr-Leu-Arg-Ile-Val-Gln-Cys-Arg-Ser-Val-Glu-Gly-Ser-Cys-Gly-Phe
- Molecular Formula (CJC1295 No DAC): C152H252N44O42
- Molecular Weight (CJC1295 No DAC): 3367.97 g/mol
- Sequence (CJC1295 No DAC): H-Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-Ser-Arg-NH2
- Molecular Formula (Ipamorelin): C38H49N9O5
- Molecular Weight (Ipamorelin): 711.85 g/mol
- Sequence (Ipamorelin): Aib-His-D-2-Nal-D-Phe-Lys-NH2
- Synonyms: HGH Fragment 176-191 (AOD9604), CJC1295 No DAC (Mod GRF), Ipamorelin (GHRP, Ghrelin mimetic)
Out of Stock
GHRP-2 10 mg
- Active Substance: Growth Hormone-Releasing Peptide 2 (GHRP-2)
- Concentration: 10 mg per vial
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: GHRP-2
- Molecular Formula: C45H55N9O6
- Molecular Weight: 818.0 g/mol
- Sequence: D-Ala-D-2-Nal-Ala-Trp-D-Phe-Lys-NH2
- Synonyms: Pralmorelin, Growth Hormone Secretagogue
Out of Stock
GHRP-2 5 mg
- Active Substance: Growth Hormone-Releasing Peptide 2 (GHRP-2)
- Concentration: 5 mg per vial
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: GHRP-2
- Molecular Formula: C45H55N9O6
- Molecular Weight: 818.0 g/mol
- Sequence: D-Ala-D-2-Nal-Ala-Trp-D-Phe-Lys-NH2
- Synonyms: Pralmorelin, Growth Hormone Secretagogue
Out of Stock
Cagrilintide
$100.00
GW 501516
$96.00
L-Carnitine 500
$70.00
Mazdutide
$100.00
MOTS-c 10mg
$70.00
5-Amino 1MQ
$30.00
Survodutide
$110.00
Tesamorelin
$80.00
Tirze-Pep 5mg
$99.00
Out Of Stock
Out Of Stock
Out Of Stock
Out Of Stock
Out Of Stock
Out Of Stock
Out Of Stock
Out Of Stock
Out Of Stock
Out Of Stock
Out Of Stock