Muscle Growth Peptides

Accelerate your studies on muscle growth and performance with our curated selection of muscle-building peptides. These compounds are widely researched for their roles in increasing lean mass, enhancing recovery, and stimulating natural growth hormone release. Featuring top compounds like IGF-1 LR3, GHRP-6, CJC-1295, and MK-677, this category delivers research-grade options trusted by professionals.
Shop now and power your research with high-purity peptides.

Showing 40 of 40 products
Image
SKU
Product
Rating
Price
Dragon Pharma

  • Active Substance: Anti-Obesity Drug-9604 (AOD 9604)
  • Concentration: 5 mg per vial
  • Pack Size: Lyophilized vial for injection-based research
  • Manufacturer: Dragon Pharma
  • Brand Name: AOD9604
  • Molecular Formula: C78H123N23O23S
  • Molecular Weight: 1815.1 g/mol
  • Sequence: Tyr-Leu-Arg-Ile-Val-Gln-Cys-Arg-Ser-Val-Glu-Gly-Ser-Cys-Gly-Phe
  • Synonyms: hGH 176–191 fragment, Fat Loss Peptide, Lipolytic GH Fragment
Dragon Pharma
  • Active Substance: Tetrasubstituted 30-Amino Acid Peptide Hormone (CJC-1295 DAC)
  • Concentration: 5 mg/ml per vial
  • Pack Size: 1 vial (lyophilized powder for reconstitution)
  • Manufacturer: Dragon Pharma
  • Brand Name: CJC-1295
  • Molecular Formula: C165H271N47O46
  • Molecular Weight: ~3649.30 g/mol
  • Synonyms: CJC-1295 with DAC, Drug Affinity Complex Peptide, GH Secretagogue
Dragon Pharma
  • Active Substance: Recombinant Human Growth Hormone (Somatropin)
  • Concentration: 100 IU per kit (multiple vials)
  • Pack Size: Full injectable peptide kit (lyophilized vials)
  • Manufacturer: Dragon Pharma
  • Brand Name: Dragontropin
  • Molecular Formula: C990H1528N262O300S7
  • Molecular Weight: ~22,125 Da
  • Sequence: 191-amino acid polypeptide identical to endogenous human GH
  • Synonyms: HGH, Somatropin, Recombinant GH, Human Growth Hormone
Dragon Pharma
  • Active Substance: GW 501516 (Cardarine)
  • Concentration: 20 mg per tablet
  • Pack Size: 100 tablets
  • Manufacturer: Dragon Pharma
  • Brand Name: Cardarine
  • Molecular Formula: C21H18F3NO3S2
  • Molecular Weight: 453.5 g/mol
  • Synonyms: Cardarine, GW1516, Endurobol
Dragon Pharma
  • Active Substance: Human Chorionic Gonadotropin (HCG)
  • Concentration: 5000 IU per kit
  • Pack Size: Lyophilized vial + sterile diluent
  • Manufacturer: Dragon Pharma
  • Brand Name: Pregnyl
  • Molecular Formula: C1107H1770N318O336S26
  • Molecular Weight: ~36,700 Da
  • Synonyms: hCG, Chorionic Gonadotropin, Human LH analog
Dragon Pharma
  • Active Substance: Hexarelin
  • Concentration: 5 mg per vial
  • Pack Size: Lyophilized injectable vial
  • Manufacturer: Dragon Pharma
  • Brand Name: Hexarelin
  • Molecular Formula: C47H58N12O6
  • Molecular Weight: 887.04 g/mol
  • Synonyms: Examorelin, Hexarelin Acetate, Growth Hormone-Releasing Peptide-6 analog
Dragon Pharma
  • Active Substance: Insulin-like Growth Factor 1, Long R3 (IGF-1 LR3)
  • Concentration: 1 mg per vial
  • Pack Size: Lyophilized injectable vial
  • Manufacturer: Dragon Pharma
  • Brand Name: IGF-1 LR3
  • Molecular Formula: C400H625N111O115S6
  • Molecular Weight: ~9111 Da
  • Synonyms: Long R3 IGF-1, LR3 IGF-1, IGF1 analogue
Dragon Pharma
  • Active Substance: Ipamorelin
  • Concentration: 5 mg per vial
  • Pack Size: Lyophilized injectable vial
  • Manufacturer: Dragon Pharma
  • Brand Name: Ipamorelin
  • Molecular Formula: C38H49N9O5
  • Molecular Weight: 711.85 g/mol
  • Synonyms: IPAM, Growth Hormone Releasing Peptide-5, GHRP-5
Dragon Pharma
  • Active Substance: Ligandrol (LGD 4033)
  • Concentration: 15 mg per tablet
  • Pack Size: 100 tablets per bottle
  • Manufacturer: Dragon Pharma
  • Brand Name: Ligandrol
  • Molecular Formula: C14H12F6N2O
  • Molecular Weight: 338.25 g/mol
  • Synonyms: LGD-4033, VK5211, Ligandrol
Dragon Pharma
  • Active Substance: Enobosarm (MK-2866, Ostarine)
  • Concentration: 25 mg per tablet
  • Pack Size: 100 tablets per bottle
  • Manufacturer: Dragon Pharma
  • Molecular Formula: C19H14F3N3O3
  • Molecular Weight: 389.33 g/mol
  • Synonyms: MK-2866, Enobosarm, GTx-024
Dragon Pharma
  • Active Substance: Ibutamoren (MK-677)
  • Concentration: 25 mg per tablet
  • Pack Size: 100 tablets per bottle
  • Manufacturer: Dragon Pharma
  • Brand Name: Ibutamoren
  • Molecular Formula: C27H36N4O5S
  • Molecular Weight: 528.66 g/mol
  • Synonyms: MK-677, Ibutamoren mesylate, Nutrobal
Dragon Pharma
  • Active Substance: Sermorelin
  • Concentration: 5 mg per vial
  • Pack Size: 1 vial (lyophilized powder)
  • Manufacturer: Dragon Pharma
  • Brand Name: Sermorelin
  • Molecular Formula: C149H246N44O42
  • Molecular Weight: 3357.89 g/mol
  • Sequence: Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg
  • Synonyms: GHRH(1-29), Growth Hormone Releasing Hormone fragment, Sermorelin Acetate
Dragon Pharma
  • Active Substance: Tesamorelin
  • Concentration: 5 mg per vial
  • Pack Size: Lyophilized injectable vial
  • Manufacturer: Dragon Pharma
  • Brand Name: Tesamorelin
  • Molecular Formula: C221H366N72O67S
  • Molecular Weight: 5135.91 g/mol
  • Synonyms: Egrifta, GHRH(1–44) analog, GHRH modulator
Peptide Sciences USA
  • Active Substance: Sermorelin (Mod GRF, GHRH 1-29) and GHRP-2 (5 mg each)
  • Concentration: 10 mg per vial (5 mg Sermorelin + 5 mg GHRP-2)
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: Peptide Blend
  • Molecular Formula (Sermorelin): C149H246N44O42S
  • Molecular Weight (Sermorelin): 3357.93 g/mol
  • Sequence (Sermorelin): Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-NH2
  • Molecular Formula (GHRP-2): C45H55N9O6
  • Molecular Weight (GHRP-2): 818.0 g/mol
  • Sequence (GHRP-2): D-Ala-D-2-Nal-Ala-Trp-D-Phe-Lys-NH2
  • Synonyms: Sermorelin (GHRH 1-29, Mod GRF), GHRP-2 (Pralmorelin)
Peptide Sciences USA
  • Active Substance: Sermorelin (GHRH 1-29) and GHRP-6 (5 mg each)
  • Concentration: 10 mg per vial (5 mg Sermorelin + 5 mg GHRP-6)
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: Peptide Blend
  • Molecular Formula (Sermorelin): C149H246N44O42S
  • Molecular Weight (Sermorelin): 3357.93 g/mol
  • Sequence (Sermorelin): Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-NH2
  • Molecular Formula (GHRP-6): C46H56N12O6
  • Molecular Weight (GHRP-6): 873.01 g/mol
  • Sequence (GHRP-6): His-D-Trp-Ala-Trp-D-Phe-Lys-NH2
  • Synonyms: Sermorelin (GHRH 1-29, Mod GRF), GHRP-6 (Growth Hormone-Releasing Hexapeptide)
Peptide Sciences USA
  • Active Substance: Sermorelin (GHRH 1-29) and Ipamorelin (5 mg each)
  • Concentration: 10 mg per vial (5 mg Sermorelin + 5 mg Ipamorelin)
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: Peptide Blend
  • Molecular Formula (Sermorelin): C149H246N44O42S
  • Molecular Weight (Sermorelin): 3357.93 g/mol
  • Sequence (Sermorelin): Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-NH2
  • Molecular Formula (Ipamorelin): C38H49N9O5
  • Molecular Weight (Ipamorelin): 711.85 g/mol
  • Sequence (Ipamorelin): Aib-His-D-2-Nal-D-Phe-Lys-NH2
  • Synonyms: Sermorelin (GHRH 1-29, Mod GRF), Ipamorelin (GHRP, Ghrelin mimetic)
Peptide Sciences USA
  • Active Substance: Growth Hormone-Releasing Peptide 2 (GHRP-2)
  • Concentration: 10 mg per vial
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: GHRP-2
  • Molecular Formula: C45H55N9O6
  • Molecular Weight: 818.0 g/mol
  • Sequence: D-Ala-D-2-Nal-Ala-Trp-D-Phe-Lys-NH2
  • Synonyms: Pralmorelin, Growth Hormone Secretagogue
Peptide Sciences USA
  • Active Substance: Growth Hormone-Releasing Peptide 2 (GHRP-2)
  • Concentration: 5 mg per vial
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: GHRP-2
  • Molecular Formula: C45H55N9O6
  • Molecular Weight: 818.0 g/mol
  • Sequence: D-Ala-D-2-Nal-Ala-Trp-D-Phe-Lys-NH2
  • Synonyms: Pralmorelin, Growth Hormone Secretagogue
Peptide Sciences USA
  • Active Substance: Growth Hormone-Releasing Peptide 6 (GHRP-6)
  • Concentration: 10 mg per vial
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: GHRP-6
  • Molecular Formula: C46H56N12O6
  • Molecular Weight: 873.01 g/mol
  • Sequence: His-D-Trp-Ala-Trp-D-Phe-Lys-NH2
  • Synonyms: Growth Hormone Secretagogue, GHRP-6
Peptide Sciences USA
  • Active Substance: Growth Hormone-Releasing Peptide 6 (GHRP-6)
  • Concentration: 5 mg per vial
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: GHRP-6
  • Molecular Formula: C46H56N12O6
  • Molecular Weight: 873.01 g/mol
  • Sequence: His-D-Trp-Ala-Trp-D-Phe-Lys-NH2
  • Synonyms: Growth Hormone Secretagogue, GHRP-6
Peptide Sciences USA
  • Active Substance: Hexarelin
  • Concentration: 2 mg per vial
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: Hexarelin
  • Molecular Formula: C47H58N12O6
  • Molecular Weight: 887.04 g/mol
  • Sequence: His-D-2-Me-Trp-Ala-Trp-D-Phe-Lys-NH2
  • Synonyms: Growth Hormone Secretagogue, Examorelin
Peptide Sciences USA
  • Active Substance: Hexarelin
  • Concentration: 5 mg per vial
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: Hexarelin
  • Molecular Formula: C47H58N12O6
  • Molecular Weight: 887.04 g/mol
  • Sequence: His-D-2-Me-Trp-Ala-Trp-D-Phe-Lys-NH2
  • Synonyms: Growth Hormone Secretagogue, Examorelin
Peptide Sciences USA
  • Active Substance: Insulin-Like Growth Factor 1, DES
  • Concentration: 1 mg per vial
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: IGF-1 DES
  • Molecular Formula: C319H501N91O96S7
  • Molecular Weight: ~7377 g/mol
  • Sequence: TLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
  • Synonyms: DES(1-3)IGF-1, Truncated IGF-1
Peptide Sciences USA
  • Active Substance: Insulin-like Growth Factor 1, Long R3
  • Concentration: 1 mg per vial
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: IGF-1 LR3
  • Molecular Formula: C400H625N111O115S9
  • Molecular Weight: 9117.5 g/mol
  • Sequence: MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
  • Synonyms: Long R3 IGF-1, LR3-IGF-1
Peptide Sciences USA
  • Active Substance: Ipamorelin
  • Concentration: 5 mg per vial
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: Ipamorelin
  • Molecular Formula: C38H49N9O5
  • Molecular Weight: 711.85 g/mol
  • Sequence: Aib-His-D-2-Nal-D-Phe-Lys-NH2
  • Synonyms: Growth Hormone Secretagogue, GHRP
Peptide Sciences USA
  • Active Substance: Ipamorelin
  • Concentration: 2 mg per vial
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: Ipamorelin
  • Molecular Formula: C38H49N9O5
  • Molecular Weight: 711.85 g/mol
  • Sequence: Aib-His-D-2-Nal-D-Phe-Lys-NH2
  • Synonyms: Growth Hormone Secretagogue, GHRP
Peptide Sciences USA
  • Active Substance: Metastin (Kisspeptin-10)
  • Concentration: 5 mg per vial
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: Kisspeptin
  • Molecular Formula: C63H83N17O14
  • Molecular Weight: 1302.4 g/mol
  • Sequence: Tyr-Asn-Trp-Asn-Ser-Phe-Gly-Leu-Arg-Phe-NH2
  • Synonyms: Kp-10, Kisspeptin, Metastin
Peptide Sciences USA
  • Active Substance: Ibutamoren (MK-677)
  • Concentration: 12.5 mg per capsule
  • Pack Size: 60 capsules
  • Manufacturer: Peptide Sciences USA
  • Brand Name: Ibutamoren
  • Molecular Formula: C27H36N4O5S
  • Molecular Weight: 528.7 g/mol
  • Synonyms: MK-0677, Oratrope, L-163,191
Peptide Sciences USA
  • Active Substance: Pegylated Mechano Growth Factor (PEG MGF)
  • Concentration: 5 mg per vial
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: PEG MGF
  • Molecular Formula: C121H200N42O39
  • Molecular Weight: ~2971.99 g/mol
  • Sequence: PEG-Suc-Tyr-Gln-Pro-Pro-Ser-Thr-Asn-Lys-Asn-Thr-Lys-Ser-Gln-Arg-Arg-Lys-Gly-Ser-Thr-Phe-Glu-Glu-Arg-Lys-Cys
  • Synonyms: Pegylated MGF, PEG IGF-1Ec, PEG Myotrophin
Peptide Sciences USA
  • Active Substances: Sermorelin, GHRP-6, GHRP-2
  • Concentration: 9 mg per vial (3 mg each peptide)
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: Peptide Blend
  • Synonyms: Sermorelin Acetate, GHRP-6 Acetate, GHRP-2 Acetate, Growth Hormone Peptide Blend
Peptide Sciences USA
  • Active Substance: Sermorelin (GHRH Analog)
  • Concentration: 10 mg per vial
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: Sermorelin
  • Molecular Formula: C149H246N44O42S
  • Molecular Weight: 3357.88 g/mol
  • Sequence: Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-NH2
  • Synonyms: Sermorelin Acetate, GHRH (1-29)
Peptide Sciences USA
  • Active Substance: Sermorelin (GHRH Analog)
  • Concentration: 2 mg per vial
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: Sermorelin
  • Molecular Formula: C149H246N44O42S
  • Molecular Weight: 3357.88 g/mol
  • Sequence: Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-NH2
  • Synonyms: Sermorelin Acetate, GHRH (1-29)
Peptide Sciences USA
  • Active Substance: SLU-PP-332 (Pan-ERR Agonist)
  • Concentration: 1000 mcg per capsule
  • Pack Size: 30 capsules (30,000 mcg total)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: SLU-PP-332
  • Molecular Formula: Not fully disclosed (medium-length peptide)
  • Molecular Weight: 290.32 g/mol
  • Sequence: Proprietary (10–30 amino acids)
  • Synonyms: SLU-PP-332, ERR Agonist, Exercise Mimetic
Peptide Sciences USA
  • Active Substance: Thymosin Beta-4 (TB-500)
  • Concentration: 2 mg per vial
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: TB-500
  • Categories: Injectable Peptides, Healing & Recovery Peptides, Muscle Growth Peptides, Immune & Longevity Support Peptides
  • Molecular Formula: C212H350N56O78S
  • Molecular Weight: 4963.49 g/mol
  • Sequence: SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
  • Synonyms: Thymosin Beta-4, TB500
Peptide Sciences USA
  • Active Substance: Thymosin Beta-4 (TB-500)
  • Concentration: 5 mg per vial
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: TB-500
  • Molecular Formula: C212H350N56O78S
  • Molecular Weight: 4963.49 g/mol
  • Synonyms: Thymosin Beta-4, TB500
Peptide Sciences USA
  • Active Substance: Tesamorelin (GHRH Analog)
  • Concentration: 5 mg per vial
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: Tesamorelin
  • Molecular Formula: C221H366N72O67S
  • Molecular Weight: 5135.9 g/mol
  • Sequence: 44 amino acids (proprietary GHRH analog)
  • Synonyms: Tesamorelin Acetate, Egrifta, TH9507
Peptide Sciences USA
  • Active Substance: Testagen (Bioregulatory Tetrapeptide)
  • Concentration: 20 mg per vial
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: Testagen
  • Molecular Formula: C17H29N5O9
  • Molecular Weight: 447.2 g/mol
  • Sequence: Lys-Glu-Asp-Gly
  • Synonyms: Testagen, KEDG, Anterior Pituitary Peptide (APP)
Peptide Sciences USA
  • Active Substance: Sermorelin
  • Concentration: 5 mg per vial
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: Sermorelin
  • Molecular Formula: C149H246N44O42S
  • Molecular Weight: 3357.96 g/mol
  • Synonyms: GHRH 1–29, Sermorelin Acetate, Growth Hormone-Releasing Factor analog
Peptide Sciences USA
  • Active Substance: Thyrotropin Releasing Hormone
  • Concentration: 50 mg per vial
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: Protirelin
  • Molecular Formula: C16H22N6O4
  • Molecular Weight: 362.38 g/mol
  • Sequence: pGlu-His-Pro-NH2
  • Synonyms: Protirelin, TRH, Thyroliberin
Dragon Pharma
  • Active Substance: Human Chorionic Gonadotropin (HCG)
  • Concentration: 2500 IU
  • Pack Size: Full kit (1 vial + diluent)
  • Manufacturer: Dragon Pharma
  • Brand Name: Pregnyl
  • Molecular Formula: C1107H1770N318O336S26
  • Molecular Weight: ~36.7 kDa
  • Synonyms: hCG, Chorionic Gonadotropin, Human LH Mimetic

Muscle Growth Peptides

Muscle growth peptides are a class of compounds studied for their ability to enhance muscle mass, improve recovery times, and support anabolic signaling pathways. These peptides are often evaluated in preclinical and experimental settings for their potential to stimulate growth hormone (GH) release, activate IGF-1 production, or enhance muscle regeneration at the cellular level.

Whether you're conducting in vitro research or animal studies, peptides in this category offer diverse mechanisms of action that can be tailored to different models and endpoints.

Popular Muscle Growth Peptides

The following peptides are commonly used in muscle growth research and are available in various forms:

  • IGF-1 LR3 – Promotes cellular hypertrophy and supports lean tissue growth
  • GHRP-6 – Stimulates GH release; often studied in combination with CJC-1295
  • CJC-1295 (with or without DAC) – Extends GH pulse and improves hormonal rhythm
  • MK-677 (Ibutamoren) – A GH secretagogue available in oral form
  • Ipamorelin – Selective and well-tolerated GH-releasing peptide
  • PEG-MGF – Studied for its role in muscle tissue repair and development

Each product is available from trusted brands like Peptide Sciences, Beligas, and Ultima, and is labeled for research use only.

Benefits of Muscle-Building Peptides in Research

These peptides are selected for their ability to support anabolic pathways without the systemic side effects associated with synthetic hormones. Researchers appreciate the flexibility in targeting:

  • Increased lean muscle mass and hypertrophy
  • Enhanced muscle recovery following injury or exercise
  • Stimulation of natural GH and IGF-1 pathways
  • Synergistic effects when combined in stacks or cycles

Because these peptides act on hormonal or tissue-specific receptors, they are valuable in a variety of experimental models involving metabolism, strength, and body composition.

Why Buy Muscle Growth Peptides from Research-Peptides.com?

At BuyPeptides.net, we source only high-purity peptides from GMP-certified and COA-backed manufacturers. Our inventory includes both injectable and oral forms of muscle growth peptides, allowing you to match your research needs precisely.

When ordering from us, you'll benefit from:

  • Verified purity with batch testing available
  • Fast global shipping in secure packaging
  • Multiple brand options like Peptide Sciences, Deus Medical, and more
  • Expert support to help you choose the right compound for your research

All muscle growth peptides are intended strictly for laboratory use and are not approved for human or veterinary application. If your focus is lean mass, performance, or GH-related pathways, this is the category for your research goals.