Home
About Us
FAQs
Articles
Contacts
News
Hello, Log In My Account
Shopping Cart $0.00
Subtotal $0.00
Shipping $0.00
Total $0.00
View Cart Checkout

Peptides By Research Purpose

Explore our catalog of peptides by research purpose, carefully organized to help you find the right compound for your specific study. Whether you're researching muscle growth, fat metabolism, cognitive performance, or regeneration, each peptide is classified by its primary experimental role.
Select your research goal below and find high-quality peptides tailored to your field of interest.

Filters

Filters

$ – $
Showing 50 of 170 products
Image
SKU
Product
Rating
Price
Only 23 hours left with this price
-30% OFF
5-Amino 1MQ - Generic Peptides Research Peptides
Generic Peptides
  • Active Substance: 5-Amino-1-methylquinolinium
  • Concentration: 10 mg
  • Pack Size: vial
  • Manufacturer: Generic Peptides
  • Brand Name: 5-Amino 1MQ
  • Molecular Formula: C10H11N2+
  • Molecular Weight: 159.21 g/mol
  • Synonyms: 5-Amino-1-methylquinolinium, NNMT Inhibitor
$21.00
$30.00
Best Seller
Only 23 hours left with this price
-30% OFF
NAD+ 250 mg - Generic Peptides Research Peptides
Generic Peptides
  • Active Substance: Nicotinamide Adenine Dinucleotide (NAD+)
  • Concentration: 250 mg per vial
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Generic Peptides
  • Brand Name: NAD
  • Molecular Formula: C21H27N7O14P2
  • Molecular Weight: 663.43 g/mol
  • Sequence: N/A (coenzyme)
  • Synonyms: Nicotinamide Adenine Dinucleotide, beta-NAD, Endopride
$59.50
$85.00
AOD 9604 5 mg - Dragon Pharma Research Peptides
Dragon Pharma

  • Active Substance: Anti-Obesity Drug-9604 (AOD 9604)
  • Concentration: 5 mg per vial
  • Pack Size: Lyophilized vial for injection-based research
  • Manufacturer: Dragon Pharma
  • Brand Name: AOD9604
  • Molecular Formula: C78H123N23O23S
  • Molecular Weight: 1815.1 g/mol
  • Sequence: Tyr-Leu-Arg-Ile-Val-Gln-Cys-Arg-Ser-Val-Glu-Gly-Ser-Cys-Gly-Phe
  • Synonyms: hGH 176–191 fragment, Fat Loss Peptide, Lipolytic GH Fragment
$75.00
BPC 157 - Dragon Pharma Research Peptides
Dragon Pharma
  • Active Substance: BPC-157 Pentadecapeptide
  • Concentration: 2 mg per vial
  • Pack Size: 1 vial (lyophilized powder)
  • Manufacturer: Dragon Pharma
  • Brand Name: BPC 157
  • Molecular Formula: C62H98N16O22
  • Molecular Weight: 1419.55 g/mol
  • Sequence: Gly-Glu-Pro-Pro-Pro-Gly-Lys-Pro-Ala-Asp-Asp-Ala-Gly-Leu-Val
  • Synonyms: Body Protection Compound-157, PL 14736
$80.00
BPC-157 5 mg / TB-500 5 mg (Blend) - Dragon Pharma Research Peptides
Dragon Pharma
  • Active Substance: Thymosin Beta 4 (TB-500) + BPC-157 Pentadecapeptide
  • Concentration: 5 mg TB-500 + 5 mg BPC-157 per vial
  • Pack Size: 1 vial (lyophilized blend for reconstitution)
  • Manufacturer: Dragon Pharma
  • Brand Name: Peptide Blend
  • Synonyms: BPC-TB Blend, Thymosin Beta-4 + BPC Research Formula, Regenerative Peptide Combo
$90.00
Cagrilintide - Dragon Pharma Research Peptides
Dragon Pharma
  • Active Substance: Cagrilintide
  • Concentration: 10 mg/ml per vial
  • Pack Size: Lyophilized injectable vial
  • Manufacturer: Dragon Pharma
  • Brand Name: Cagrilintide
  • Molecular Formula: C135H224N42O40S
  • Molecular Weight: ~3400 g/mol
  • Synonyms: AM833, Amylin Receptor Agonist, Long-Acting Amylin Analog
$100.00
CJC-1295 Dac 5mg - Dragon Pharma Research Peptides
Dragon Pharma
  • Active Substance: Tetrasubstituted 30-Amino Acid Peptide Hormone (CJC-1295 DAC)
  • Concentration: 5 mg/ml per vial
  • Pack Size: 1 vial (lyophilized powder for reconstitution)
  • Manufacturer: Dragon Pharma
  • Brand Name: CJC-1295
  • Molecular Formula: C165H271N47O46
  • Molecular Weight: ~3649.30 g/mol
  • Synonyms: CJC-1295 with DAC, Drug Affinity Complex Peptide, GH Secretagogue
$69.00
Dragontropin - Dragon Pharma Research Peptides
Dragon Pharma
  • Active Substance: Recombinant Human Growth Hormone (Somatropin)
  • Concentration: 100 IU per kit (multiple vials)
  • Pack Size: Full injectable peptide kit (lyophilized vials)
  • Manufacturer: Dragon Pharma
  • Brand Name: Dragontropin
  • Molecular Formula: C990H1528N262O300S7
  • Molecular Weight: ~22,125 Da
  • Sequence: 191-amino acid polypeptide identical to endogenous human GH
  • Synonyms: HGH, Somatropin, Recombinant GH, Human Growth Hormone
$299.00
Epitalon - Dragon Pharma Research Peptides
Dragon Pharma

  • Active Substance: Epitalon
  • Concentration: 50 mg per vial
  • Pack Size: 1 vial (lyophilized powder for research reconstitution)
  • Manufacturer: Dragon Pharma
  • Brand Name: Epitalon
  • Molecular Formula: C14H22N4O9
  • Molecular Weight: 390.35 g/mol
  • Sequence: Ala-Glu-Asp-Gly
  • Synonyms: Epithalon, Epithalamin, Pineal Peptide, Anti-Aging Peptide
$115.00
GW 501516 - Dragon Pharma Research Peptides
Dragon Pharma
  • Active Substance: GW 501516 (Cardarine)
  • Concentration: 20 mg per tablet
  • Pack Size: 100 tablets
  • Manufacturer: Dragon Pharma
  • Brand Name: Cardarine
  • Molecular Formula: C21H18F3NO3S2
  • Molecular Weight: 453.5 g/mol
  • Synonyms: Cardarine, GW1516, Endurobol
$96.00
HCG 5000 IU - Dragon Pharma Research Peptides
Dragon Pharma
  • Active Substance: Human Chorionic Gonadotropin (HCG)
  • Concentration: 5000 IU per kit
  • Pack Size: Lyophilized vial + sterile diluent
  • Manufacturer: Dragon Pharma
  • Brand Name: Pregnyl
  • Molecular Formula: C1107H1770N318O336S26
  • Molecular Weight: ~36,700 Da
  • Synonyms: hCG, Chorionic Gonadotropin, Human LH analog
$50.00
Hexarelin 5 mg - Dragon Pharma Research Peptides
Dragon Pharma
  • Active Substance: Hexarelin
  • Concentration: 5 mg per vial
  • Pack Size: Lyophilized injectable vial
  • Manufacturer: Dragon Pharma
  • Brand Name: Hexarelin
  • Molecular Formula: C47H58N12O6
  • Molecular Weight: 887.04 g/mol
  • Synonyms: Examorelin, Hexarelin Acetate, Growth Hormone-Releasing Peptide-6 analog
$49.00
IGF-1 LR3 - Dragon Pharma Research Peptides
Dragon Pharma
  • Active Substance: Insulin-like Growth Factor 1, Long R3 (IGF-1 LR3)
  • Concentration: 1 mg per vial
  • Pack Size: Lyophilized injectable vial
  • Manufacturer: Dragon Pharma
  • Brand Name: IGF-1 LR3
  • Molecular Formula: C400H625N111O115S6
  • Molecular Weight: ~9111 Da
  • Synonyms: Long R3 IGF-1, LR3 IGF-1, IGF1 analogue
$90.00
Ipamorelin - Dragon Pharma Research Peptides
Dragon Pharma
  • Active Substance: Ipamorelin
  • Concentration: 5 mg per vial
  • Pack Size: Lyophilized injectable vial
  • Manufacturer: Dragon Pharma
  • Brand Name: Ipamorelin
  • Molecular Formula: C38H49N9O5
  • Molecular Weight: 711.85 g/mol
  • Synonyms: IPAM, Growth Hormone Releasing Peptide-5, GHRP-5
$45.00
L-Carnitine 500 - Dragon Pharma Research Peptides
Dragon Pharma
  • Active Substance: L-Carnitine
  • Concentration: 500 mg/ml
  • Pack Size: 1 x vial (injectable solution)
  • Manufacturer: Dragon Pharma
  • Brand Name: L-Carnitine
  • Molecular Formula: C7H15NO3
  • Molecular Weight: 161.2 g/mol
  • Synonyms: Levocarnitine, L-3-hydroxy-4-N-trimethylaminobutyric acid
$70.00
LGD 4033 - Dragon Pharma Research Peptides
Dragon Pharma
  • Active Substance: Ligandrol (LGD 4033)
  • Concentration: 15 mg per tablet
  • Pack Size: 100 tablets per bottle
  • Manufacturer: Dragon Pharma
  • Brand Name: Ligandrol
  • Molecular Formula: C14H12F6N2O
  • Molecular Weight: 338.25 g/mol
  • Synonyms: LGD-4033, VK5211, Ligandrol
$95.00
Mazdutide - Dragon Pharma Research Peptides
Dragon Pharma
  • Active Substance: Mazdutide
  • Concentration: 10 mg/ml
  • Pack Size: 1 x vial (injectable solution)
  • Manufacturer: Dragon Pharma
  • Brand Name: Mazdutide
  • Molecular Formula: C219H358N64O68
  • Molecular Weight: Approx. 5100 g/mol
  • Synonyms: Oxyntomodulin analog, GLP-1/GCGR dual agonist
$100.00
Melanotan II - Dragon Pharma Research Peptides
Dragon Pharma
  • Active Substance: Melanotan II Peptide Hormone
  • Concentration: 10 mg per vial
  • Pack Size: 1 x vial (lyophilized powder)
  • Manufacturer: Dragon Pharma
  • Brand Name: Melanotan
  • Molecular Formula: C50H69N15O9
  • Molecular Weight: 1024.2 g/mol
  • Synonyms: MT-II, MT2, Melanotan 2
$49.00
MK 2866 (Ostarine) - Dragon Pharma Research Peptides
Dragon Pharma
  • Active Substance: Enobosarm (MK-2866, Ostarine)
  • Concentration: 25 mg per tablet
  • Pack Size: 100 tablets per bottle
  • Manufacturer: Dragon Pharma
  • Molecular Formula: C19H14F3N3O3
  • Molecular Weight: 389.33 g/mol
  • Synonyms: MK-2866, Enobosarm, GTx-024
$125.00
MK 677 (Ibutamoren) - Dragon Pharma Research Peptides
Dragon Pharma
  • Active Substance: Ibutamoren (MK-677)
  • Concentration: 25 mg per tablet
  • Pack Size: 100 tablets per bottle
  • Manufacturer: Dragon Pharma
  • Brand Name: Ibutamoren
  • Molecular Formula: C27H36N4O5S
  • Molecular Weight: 528.66 g/mol
  • Synonyms: MK-677, Ibutamoren mesylate, Nutrobal
$175.00
MOTS-c 10mg - Dragon Pharma Research Peptides
Dragon Pharma
  • Active Substance: MOTS-c
  • Concentration: 10 mg per vial
  • Pack Size: 1 vial (lyophilized powder)
  • Manufacturer: Dragon Pharma
  • Brand Name: MOTS-c
  • Molecular Formula: C49H75N15O10
  • Molecular Weight: 1020.21 g/mol
  • Synonyms: Mitochondrial Open Reading Frame of the 12S rRNA-c, MDP-1
$70.00
PT-141 - Dragon Pharma Research Peptides
Dragon Pharma
  • Active Substance: Bremelanotide (PT-141)
  • Concentration: 10 mg per vial
  • Pack Size: 1 vial (lyophilized powder)
  • Manufacturer: Dragon Pharma
  • Brand Name: PT-141
  • Molecular Formula: C50H68N14O10
  • Molecular Weight: 1025.2 g/mol
  • Synonyms: PT-141, Bremelanotide Acetate
$49.00
Raloxifene - Dragon Pharma Research Peptides
Dragon Pharma
  • Active Substance: Raloxifene Hydrochloride
  • Concentration: 60 mg per tablet
  • Pack Size: 100 tablets per bottle
  • Manufacturer: Dragon Pharma
  • Brand Name: Evista
  • Molecular Formula: C28H27NO4S•HCl
  • Molecular Weight: 510.04 g/mol
  • Synonyms: Evista, Raloxifene HCl, SERM-60
$105.00
Selank - Dragon Pharma Research Peptides
Dragon Pharma
  • Active Substance: Selank Anxiolytic Peptide
  • Concentration: 10 mg per vial
  • Pack Size: 1 vial (lyophilized powder)
  • Manufacturer: Dragon Pharma
  • Brand Name: Selank
  • Molecular Formula: C33H57N11O9
  • Molecular Weight: 751.9 g/mol
  • Synonyms: TP-7, Selanc, Tuftsin analog, Anxiolytic neuropeptide
$60.00
Semax - Dragon Pharma Research Peptides
Dragon Pharma
  • Active Substance: Semax Heptapeptide
  • Concentration: 5 mg per vial
  • Pack Size: 1 vial (lyophilized powder)
  • Manufacturer: Dragon Pharma
  • Brand Name: Semax
  • Molecular Formula: C37H51N9O10S
  • Molecular Weight: 831.93 g/mol
  • Sequence: Met-Glu-His-Phe-Pro-Gly-Pro
  • Synonyms: ACTH(4-10) analog, Heptapeptide Semax, Cognitive Peptide
$59.00
Sermorelin - Dragon Pharma Research Peptides
Dragon Pharma
  • Active Substance: Sermorelin
  • Concentration: 5 mg per vial
  • Pack Size: 1 vial (lyophilized powder)
  • Manufacturer: Dragon Pharma
  • Brand Name: Sermorelin
  • Molecular Formula: C149H246N44O42
  • Molecular Weight: 3357.89 g/mol
  • Sequence: Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg
  • Synonyms: GHRH(1-29), Growth Hormone Releasing Hormone fragment, Sermorelin Acetate
$45.00
Survodutide - Dragon Pharma Research Peptides
Dragon Pharma
  • Active Substance: Survodutide
  • Concentration: 10 mg/ml
  • Pack Size: Single vial
  • Manufacturer: Dragon Pharma
  • Brand Name: Survodutide
  • Molecular Formula: C187H293N51O57
  • Molecular Weight: Approx. 4200 g/mol
  • Synonyms: HM15211, Dual GLP-1/Glucagon Agonist, GLP-GCG peptide
$110.00
TB 500 - Dragon Pharma Research Peptides
Dragon Pharma
  • Active Substance: Thymosin Beta 4 (TB 500)
  • Concentration: 5 mg per vial
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Dragon Pharma
  • Brand Name: TB 500
  • Molecular Formula: C212H350N56O78S
  • Molecular Weight: 4963.49 g/mol
  • Synonyms: TB500, Thymosin Beta-4 Fragment, Fequesetide
$55.00
Tesamorelin - Dragon Pharma Research Peptides
Dragon Pharma
  • Active Substance: Tesamorelin
  • Concentration: 5 mg per vial
  • Pack Size: Lyophilized injectable vial
  • Manufacturer: Dragon Pharma
  • Brand Name: Tesamorelin
  • Molecular Formula: C221H366N72O67S
  • Molecular Weight: 5135.91 g/mol
  • Synonyms: Egrifta, GHRH(1–44) analog, GHRH modulator
$80.00
Tirze-Pep 5mg - Dragon Pharma Research Peptides
Dragon Pharma
  • Active Substance: Tirzepatide
  • Concentration: 5 mg per vial
  • Pack Size: Lyophilized injectable vial
  • Manufacturer: Dragon Pharma
  • Brand Name: Tirze-Pep
  • Molecular Formula: C225H348N56O64
  • Molecular Weight: 4813.5 g/mol
  • Synonyms: LY3298176, GLP-1/GIP dual agonist
$99.00
5-Amino-1MQ 50 mg - Peptide Sciences USA Research Peptides
Peptide Sciences USA

  • Active Substance: 5-Amino-1-methylquinolinium
  • Concentration: 50 mg per capsule
  • Pack Size: 60 capsules
  • Manufacturer: Peptide Sciences USA
  • Brand Name: 5-Amino 1MQ
  • Molecular Formula: C10H11N2
  • Molecular Weight: 159.21 g/mol
  • Synonyms: 5-Amino-1-methylquinolinium, NNMT Inhibitor
Out of Stock
Acetyl Hexapeptide-3 200 mg - Peptide Sciences USA Research Peptides
Peptide Sciences USA
  • Active Substance: Acetyl hexapeptide-3
  • Concentration: 200 mg
  • Pack Size: Topical formulation
  • Manufacturer: Peptide Sciences USA
  • Brand Name: Argireline
  • Molecular Formula: C34H60N14O12S
  • Molecular Weight: 888.99 g/mol
  • Synonyms: Argireline, Acetyl hexapeptide-8
Out of Stock
Adipotide (FTPP) 10mg - Peptide Sciences USA Research Peptides
Peptide Sciences USA
  • Active Substance: Prohibitin-targeting peptide 1
  • Concentration: 10 mg per vial
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: Adipotide
  • Molecular Formula: C152H252N44O42
  • Molecular Weight: 2611.41 g/mol
  • Sequence: CKGGRAKDC-GG-D(KLAKLAK)2
  • Synonyms: FTPP, Fat-Targeted Proapoptotic Peptide, Prohibitin-TP01
Out of Stock
AHK (Tripeptide-3) 200 mg - Peptide Sciences USA Research Peptides
Peptide Sciences USA
  • Active Substance: Copper Tripeptide-3
  • Concentration: 200 mg
  • Pack Size: Topical formulation
  • Manufacturer: Peptide Sciences USA
  • Brand Name: AHK
  • Molecular Formula: C15H26CuN6O4
  • Molecular Weight: 416.94 g/mol
  • Sequence: Ala-His-Lys
  • Synonyms: AHK-Cu, Copper Tripeptide-3, Alanine-Histidine-Lysine-Copper
Out of Stock
AHK-Cu 200 mg - Peptide Sciences USA Research Peptides
Peptide Sciences USA
  • Active Substance: Copper Tripeptide-3
  • Concentration: 200 mg
  • Pack Size: Topical formulation
  • Manufacturer: Peptide Sciences USA
  • Brand Name: AHK
  • Molecular Formula: C15H26CuN6O4
  • Molecular Weight: 416.94 g/mol
  • Sequence: Ala-His-Lys
  • Synonyms: Copper Tripeptide-3, Alanyl-Histidyl-Lysine-Copper, AHK Copper
Out of Stock
AOD9604 6 mg - Peptide Sciences USA Research Peptides
Peptide Sciences USA
  • Active Substance: Anti-Obesity Drug-9604
  • Concentration: 6 mg per vial
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: AOD9604
  • Molecular Formula: C78H123N23O23S2
  • Molecular Weight: 1815.08 g/mol
  • Sequence: Tyr-Leu-Arg-Ile-Val-Gln-Cys-Arg-Ser-Val-Glu-Gly-Ser-Cys-Gly-Phe
  • Synonyms: hGH Fragment 177-191, Anti-Obesity Peptide
Out of Stock
ARA-290 - Peptide Sciences USA Research Peptides
Peptide Sciences USA
  • Active Substance: ARA290
  • Concentration: 16 mg per vial
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: ARA-290
  • Molecular Formula: C51H84N16O21
  • Molecular Weight: 1257 Da
  • Sequence: Pyroglu-Glu-Gln-Leu-Glu-Arg-Ala-Leu-Asn-Ser-Ser
  • Synonyms: Cibinetide, Pyroglutamate Helix B Surface Peptide
Out of Stock
B7-33 6 mg - Peptide Sciences USA Research Peptides
Peptide Sciences USA
  • Active Substance: Relaxin Receptor 1 Agonist
  • Concentration: 6 mg per vial
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: B7-33
  • Molecular Formula: C127H212N44O34
  • Molecular Weight: ~2951 Da
  • Sequence: VIKLSGRELVRAQIAISGMSTWSKRSL
  • Synonyms: (B7-33)H2, Single-Chain Relaxin Analog, GTPL9321
Out of Stock
BPC-157 10 mg - Peptide Sciences USA Research Peptides
Peptide Sciences USA
  • Active Substance: BPC-157 Pentadecapeptide
  • Concentration: 10 mg per vial
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: BPC 157
  • Molecular Formula: C62H98N16O22
  • Molecular Weight: 1419.54 g/mol
  • Sequence: Gly-Glu-Pro-Pro-Pro-Gly-Lys-Pro-Ala-Pro-Pro-Ala-Glu-Gly-Lys
  • Synonyms: Body Protection Compound-157, Pentadecapeptide BPC
Out of Stock
BPC-157 5 mg - Peptide Sciences USA Research Peptides
Peptide Sciences USA
  • Active Substance: BPC-157 Pentadecapeptide
  • Concentration: 5 mg per vial
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: BPC 157
  • Molecular Formula: C62H98N16O22
  • Molecular Weight: 1419.54 g/mol
  • Sequence: Gly-Glu-Pro-Pro-Pro-Gly-Lys-Pro-Ala-Pro-Pro-Ala-Glu-Gly-Lys
  • Synonyms: Body Protection Compound-157, Pentadecapeptide BPC
Out of Stock
BPC-157/TB-500 10 mg Blend - Peptide Sciences USA Research Peptides
Peptide Sciences USA
  • Active Substance: Thymosin beta 4 / Pentadecapeptide (5 mg BPC-157 + 5 mg TB-500)
  • Concentration: 10 mg per vial (5 mg each peptide)
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: Peptide Blend
  • Molecular Formula (BPC-157): C62H98N16O22
  • Molecular Weight (BPC-157): 1419.54 g/mol
  • Sequence (BPC-157): Gly-Glu-Pro-Pro-Pro-Gly-Lys-Pro-Ala-Pro-Pro-Ala-Glu-Gly-Lys
  • Molecular Formula (TB-500): C38H68N10O14
  • Molecular Weight (TB-500): 889.01 g/mol
  • Sequence (TB-500): Ac-LKKTETQ
  • Synonyms: BPC-157 (Body Protection Compound-157), TB-500 (Thymosin Beta-4 fragment)
Out of Stock
BPC-157/TB-500 20 mg Blend - Peptide Sciences USA Research Peptides
Peptide Sciences USA
  • Active Substance: Thymosin beta 4 / Pentadecapeptide (10 mg BPC-157 + 10 mg TB-500)
  • Concentration: 20 mg per vial (10 mg each peptide)
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Molecular Formula (BPC-157): C62H98N16O22
  • Molecular Weight (BPC-157): 1419.54 g/mol
  • Sequence (BPC-157): Gly-Glu-Pro-Pro-Pro-Gly-Lys-Pro-Ala-Pro-Pro-Ala-Glu-Gly-Lys
  • Molecular Formula (TB-500): C38H68N10O14
  • Molecular Weight (TB-500): 889.01 g/mol
  • Sequence (TB-500): Ac-LKKTETQ
  • Synonyms: BPC-157 (Body Protection Compound-157), TB-500 (Thymosin Beta-4 fragment)
Out of Stock
BPC-157/TB-500/GHK-Cu 30 mg - Peptide Sciences USA Research Peptides
Peptide Sciences USA
  • Active Substance: Thymosin beta 4 / Pentadecapeptide / GHK-Cu (10 mg BPC-157 + 10 mg TB-500 + 10 mg GHK-Cu)
  • Concentration: 30 mg per vial (10 mg each peptide)
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: Peptide Blend
  • Molecular Formula (BPC-157): C62H98N16O22
  • Molecular Weight (BPC-157): 1419.54 g/mol
  • Sequence (BPC-157): Gly-Glu-Pro-Pro-Pro-Gly-Lys-Pro-Ala-Pro-Pro-Ala-Glu-Gly-Lys
  • Molecular Formula (TB-500): C38H68N10O14
  • Molecular Weight (TB-500): 889.01 g/mol
  • Sequence (TB-500): Ac-LKKTETQ
  • Molecular Formula (GHK-Cu): C14H24CuN6O4
  • Molecular Weight (GHK-Cu): 340.87 g/mol (excluding copper)
  • Sequence (GHK-Cu): Glycyl-Histidyl-Lysine
  • Synonyms: BPC-157 (Body Protection Compound-157), TB-500 (Thymosin Beta-4 fragment), GHK-Cu (Copper Tripeptide-1)
Out of Stock
Bronchogen 20 mg - Peptide Sciences USA Research Peptides
Peptide Sciences USA
  • Active Substance: Bronchogen
  • Concentration: 20 mg per vial
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: Bronchogen
  • Molecular Formula: C18H30N4O9
  • Molecular Weight: 446.45 g/mol
  • Sequence: Ala-Glu-Asp-Leu
  • Synonyms: AEDL, Bronchial Peptide Bioregulator
Out of Stock
Cagrilintide 10 mg - Peptide Sciences USA Research Peptides
Peptide Sciences USA
  • Active Substance: Cagrilintide
  • Concentration: 10 mg per vial
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: Cagrilintide
  • Molecular Formula: C194H312N54O59S2.xC2H4O2
  • Molecular Weight: 4409.01 g/mol
  • Sequence: XKCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP
  • Synonyms: AM833, AT42613
Out of Stock
Cardiogen 20 mg - Peptide Sciences USA Research Peptides
Peptide Sciences USA
  • Active Substance: Cardiogen
  • Concentration: 20 mg per vial
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: Cardiogen
  • Molecular Formula: C18H31N7O9
  • Molecular Weight: 489.5 g/mol
  • Sequence: Ala-Glu-Asp-Arg
Out of Stock
Cartalax 20 mg - Peptide Sciences USA Research Peptides
Peptide Sciences USA
  • Active Substance: Cartalax
  • Concentration: 20 mg per vial
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: Cartalax
  • Molecular Formula: C12H19N3O8
  • Molecular Weight: 333.29 g/mol
  • Sequence: Ala-Glu-Asp
  • Synonyms: AED, T-31, SCHEMBL5324601
Out of Stock
Chonluten 20 mg - Peptide Sciences USA Research Peptides
Peptide Sciences USA
  • Active Substance: Chonluten
  • Concentration: 20 mg per vial
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: Chonluten
  • Molecular Formula: C11H17N3O8
  • Molecular Weight: 319.27 g/mol
  • Sequence: Glu-Asp-Gly
  • Synonyms: Tripeptide T-34, EDG, AC-7
Out of Stock
CJC-1295 (No DAC) / Ipamorelin 10 mg - Peptide Sciences USA Research Peptides
Peptide Sciences USA
  • Active Substance: Duo-Blend CJC-1295 No DAC and Ipamorelin (5 mg each)
  • Concentration: 10 mg per vial (5 mg CJC-1295 No DAC + 5 mg Ipamorelin)
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: Peptide Blend
  • Molecular Formula (CJC-1295 No DAC): C152H252N44O42
  • Molecular Weight (CJC-1295 No DAC): 3367.97 g/mol
  • Sequence (CJC-1295 No DAC): H-Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-Ser-Arg-NH2
  • Molecular Formula (Ipamorelin): C38H49N9O5
  • Molecular Weight (Ipamorelin): 711.85 g/mol
  • Sequence (Ipamorelin): Aib-His-D-2-Nal-D-Phe-Lys-NH2
  • Synonyms: CJC-1295 No DAC (Modified GRF 1-29, Sermorelin analog), Ipamorelin (GHRP, Ghrelin mimetic)
Out of Stock
CJC-1295 / GHRP-6 10 mg - Peptide Sciences USA Research Peptides
Peptide Sciences USA
  • Product Title: CJC-1295 / GHRP-2 10 mg
  • Active Substance: Tetrasubstituted 30-Amino Acid Peptide Hormone / Growth Hormone-Releasing Peptide 2 (5 mg CJC-1295 No DAC + 5 mg GHRP-2)
  • Concentration: 10 mg per vial (5 mg each peptide)
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: Peptide Blend
  • Molecular Formula (CJC-1295 No DAC): C152H252N44O42
  • Molecular Weight (CJC-1295 No DAC): 3367.97 g/mol
  • Sequence (CJC-1295 No DAC): H-Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-Ser-Arg-NH2
  • Molecular Formula (GHRP-2): C45H55N9O6
  • Molecular Weight (GHRP-2): 818.0 g/mol
  • Sequence (GHRP-2): D-Ala-D-2-Nal-Ala-Trp-D-Phe-Lys-NH2
  • Synonyms: CJC-1295 No DAC (Modified GRF 1-29, Sermorelin analog), GHRP-2 (Pralmorelin, Growth Hormone-Releasing Peptide-2)
Out of Stock
Showing 50 of 170 products

What Are Peptides by Research Purpose?

Peptides by research purpose refers to the classification of compounds based on their intended use in scientific, preclinical, or laboratory studies. Each peptide in this section has been categorized according to the biological processes it supports or the experimental outcome it targets. This structure allows researchers to quickly locate compounds relevant to their study, whether it involves growth hormone modulation, metabolic function, cognitive enhancement, or healing.

Research Categories

We offer peptides grouped under the following functional areas:

  • Muscle Growth Peptides – Compounds like IGF-1 LR3 and GHRP-6 support lean mass and hypertrophy
  • Fat Loss Peptides – Fragment 176-191, AOD-9604, and Tesamorelin aid in metabolic studies
  • Healing & Recovery Peptides – BPC-157 and TB-500 are popular for regeneration and tissue repair research
  • Anti-Aging & Skin Health – Epitalon, GHK-Cu, and Thymalin offer cosmetic and longevity potential
  • Nootropic Peptides – Semax and Selank support cognitive and neurological research
  • Tanning & Pigmentation – Melanotan II is widely used in pigmentation and UV-response studies
  • Sexual Wellness Peptides – PT-141 and related compounds are researched in sexual function models

Each peptide is labeled for research use only and is offered in multiple formats including vials, capsules, and topicals depending on the compound.

Benefits of Purpose-Based Peptide Selection

Classifying peptides by research use improves efficiency in protocol planning and enhances scientific focus. Instead of browsing alphabetically or by manufacturer, you can now browse by biological outcome. This helps researchers:

  • Quickly identify relevant peptides for their field
  • Compare similar compounds by effect or mechanism
  • Build custom stacks for multi-goal research
  • Streamline lab procurement based on functional need

This organization also improves SEO, making it easier for users to find what they need via search engines.

Why Shop Research Peptides by Purpose at Research-Peptides.com?

At BuyPeptides.net, we prioritize both product quality and navigational clarity. That's why we've created this category structure to help you focus on your core research goals. Our peptides come from certified manufacturers and are verified through batch testing and third-party analysis where available.

Here's why labs and research professionals choose us:

  • GMP-grade peptides across all research purposes
  • Multiple formats including injectable, oral, and topical options
  • Fast global shipping and reliable tracking
  • Secure checkout and encrypted order processing

All products are sold for research use only. Whether you're exploring hormone pathways, fat metabolism, cognitive effects, or healing mechanisms, this section helps you find the right tool for your study.

Menu
Account Cart