Home
About Us
FAQs
Articles
Contacts
News
Hello, Log In My Account
Shopping Cart $0.00
Subtotal $0.00
Shipping $0.00
Total $0.00
View Cart Checkout

Immune & Longevity Support Peptides

Explore our curated range of immune and longevity peptides, specifically selected for research into cellular aging, immune system modulation, oxidative stress, and telomerase activity. These compounds include powerful agents like Epitalon, Thymalin, and Pinealon, all of which are being studied for their regenerative and anti-aging effects.
Shop high-purity peptides to support your immunological and longevity research.

Filters

Filters

$ – $
Showing 50 of 61 products
Image
SKU
Product
Rating
Price
BPC 157 - Dragon Pharma Research Peptides
Dragon Pharma
  • Active Substance: BPC-157 Pentadecapeptide
  • Concentration: 2 mg per vial
  • Pack Size: 1 vial (lyophilized powder)
  • Manufacturer: Dragon Pharma
  • Brand Name: BPC 157
  • Molecular Formula: C62H98N16O22
  • Molecular Weight: 1419.55 g/mol
  • Sequence: Gly-Glu-Pro-Pro-Pro-Gly-Lys-Pro-Ala-Asp-Asp-Ala-Gly-Leu-Val
  • Synonyms: Body Protection Compound-157, PL 14736
$80.00
BPC-157 5 mg / TB-500 5 mg (Blend) - Dragon Pharma Research Peptides
Dragon Pharma
  • Active Substance: Thymosin Beta 4 (TB-500) + BPC-157 Pentadecapeptide
  • Concentration: 5 mg TB-500 + 5 mg BPC-157 per vial
  • Pack Size: 1 vial (lyophilized blend for reconstitution)
  • Manufacturer: Dragon Pharma
  • Brand Name: Peptide Blend
  • Synonyms: BPC-TB Blend, Thymosin Beta-4 + BPC Research Formula, Regenerative Peptide Combo
$90.00
CJC-1295 Dac 5mg - Dragon Pharma Research Peptides
Dragon Pharma
  • Active Substance: Tetrasubstituted 30-Amino Acid Peptide Hormone (CJC-1295 DAC)
  • Concentration: 5 mg/ml per vial
  • Pack Size: 1 vial (lyophilized powder for reconstitution)
  • Manufacturer: Dragon Pharma
  • Brand Name: CJC-1295
  • Molecular Formula: C165H271N47O46
  • Molecular Weight: ~3649.30 g/mol
  • Synonyms: CJC-1295 with DAC, Drug Affinity Complex Peptide, GH Secretagogue
$69.00
Epitalon - Dragon Pharma Research Peptides
Dragon Pharma

  • Active Substance: Epitalon
  • Concentration: 50 mg per vial
  • Pack Size: 1 vial (lyophilized powder for research reconstitution)
  • Manufacturer: Dragon Pharma
  • Brand Name: Epitalon
  • Molecular Formula: C14H22N4O9
  • Molecular Weight: 390.35 g/mol
  • Sequence: Ala-Glu-Asp-Gly
  • Synonyms: Epithalon, Epithalamin, Pineal Peptide, Anti-Aging Peptide
$115.00
Mazdutide - Dragon Pharma Research Peptides
Dragon Pharma
  • Active Substance: Mazdutide
  • Concentration: 10 mg/ml
  • Pack Size: 1 x vial (injectable solution)
  • Manufacturer: Dragon Pharma
  • Brand Name: Mazdutide
  • Molecular Formula: C219H358N64O68
  • Molecular Weight: Approx. 5100 g/mol
  • Synonyms: Oxyntomodulin analog, GLP-1/GCGR dual agonist
$100.00
MOTS-c 10mg - Dragon Pharma Research Peptides
Dragon Pharma
  • Active Substance: MOTS-c
  • Concentration: 10 mg per vial
  • Pack Size: 1 vial (lyophilized powder)
  • Manufacturer: Dragon Pharma
  • Brand Name: MOTS-c
  • Molecular Formula: C49H75N15O10
  • Molecular Weight: 1020.21 g/mol
  • Synonyms: Mitochondrial Open Reading Frame of the 12S rRNA-c, MDP-1
$70.00
Raloxifene - Dragon Pharma Research Peptides
Dragon Pharma
  • Active Substance: Raloxifene Hydrochloride
  • Concentration: 60 mg per tablet
  • Pack Size: 100 tablets per bottle
  • Manufacturer: Dragon Pharma
  • Brand Name: Evista
  • Molecular Formula: C28H27NO4S•HCl
  • Molecular Weight: 510.04 g/mol
  • Synonyms: Evista, Raloxifene HCl, SERM-60
$105.00
Selank - Dragon Pharma Research Peptides
Dragon Pharma
  • Active Substance: Selank Anxiolytic Peptide
  • Concentration: 10 mg per vial
  • Pack Size: 1 vial (lyophilized powder)
  • Manufacturer: Dragon Pharma
  • Brand Name: Selank
  • Molecular Formula: C33H57N11O9
  • Molecular Weight: 751.9 g/mol
  • Synonyms: TP-7, Selanc, Tuftsin analog, Anxiolytic neuropeptide
$60.00
Semax - Dragon Pharma Research Peptides
Dragon Pharma
  • Active Substance: Semax Heptapeptide
  • Concentration: 5 mg per vial
  • Pack Size: 1 vial (lyophilized powder)
  • Manufacturer: Dragon Pharma
  • Brand Name: Semax
  • Molecular Formula: C37H51N9O10S
  • Molecular Weight: 831.93 g/mol
  • Sequence: Met-Glu-His-Phe-Pro-Gly-Pro
  • Synonyms: ACTH(4-10) analog, Heptapeptide Semax, Cognitive Peptide
$59.00
Sermorelin - Dragon Pharma Research Peptides
Dragon Pharma
  • Active Substance: Sermorelin
  • Concentration: 5 mg per vial
  • Pack Size: 1 vial (lyophilized powder)
  • Manufacturer: Dragon Pharma
  • Brand Name: Sermorelin
  • Molecular Formula: C149H246N44O42
  • Molecular Weight: 3357.89 g/mol
  • Sequence: Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg
  • Synonyms: GHRH(1-29), Growth Hormone Releasing Hormone fragment, Sermorelin Acetate
$45.00
Survodutide - Dragon Pharma Research Peptides
Dragon Pharma
  • Active Substance: Survodutide
  • Concentration: 10 mg/ml
  • Pack Size: Single vial
  • Manufacturer: Dragon Pharma
  • Brand Name: Survodutide
  • Molecular Formula: C187H293N51O57
  • Molecular Weight: Approx. 4200 g/mol
  • Synonyms: HM15211, Dual GLP-1/Glucagon Agonist, GLP-GCG peptide
$110.00
TB 500 - Dragon Pharma Research Peptides
Dragon Pharma
  • Active Substance: Thymosin Beta 4 (TB 500)
  • Concentration: 5 mg per vial
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Dragon Pharma
  • Brand Name: TB 500
  • Molecular Formula: C212H350N56O78S
  • Molecular Weight: 4963.49 g/mol
  • Synonyms: TB500, Thymosin Beta-4 Fragment, Fequesetide
$55.00
Tirze-Pep 5mg - Dragon Pharma Research Peptides
Dragon Pharma
  • Active Substance: Tirzepatide
  • Concentration: 5 mg per vial
  • Pack Size: Lyophilized injectable vial
  • Manufacturer: Dragon Pharma
  • Brand Name: Tirze-Pep
  • Molecular Formula: C225H348N56O64
  • Molecular Weight: 4813.5 g/mol
  • Synonyms: LY3298176, GLP-1/GIP dual agonist
$99.00
ARA-290 - Peptide Sciences USA Research Peptides
Peptide Sciences USA
  • Active Substance: ARA290
  • Concentration: 16 mg per vial
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: ARA-290
  • Molecular Formula: C51H84N16O21
  • Molecular Weight: 1257 Da
  • Sequence: Pyroglu-Glu-Gln-Leu-Glu-Arg-Ala-Leu-Asn-Ser-Ser
  • Synonyms: Cibinetide, Pyroglutamate Helix B Surface Peptide
Out of Stock
B7-33 6 mg - Peptide Sciences USA Research Peptides
Peptide Sciences USA
  • Active Substance: Relaxin Receptor 1 Agonist
  • Concentration: 6 mg per vial
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: B7-33
  • Molecular Formula: C127H212N44O34
  • Molecular Weight: ~2951 Da
  • Sequence: VIKLSGRELVRAQIAISGMSTWSKRSL
  • Synonyms: (B7-33)H2, Single-Chain Relaxin Analog, GTPL9321
Out of Stock
Bronchogen 20 mg - Peptide Sciences USA Research Peptides
Peptide Sciences USA
  • Active Substance: Bronchogen
  • Concentration: 20 mg per vial
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: Bronchogen
  • Molecular Formula: C18H30N4O9
  • Molecular Weight: 446.45 g/mol
  • Sequence: Ala-Glu-Asp-Leu
  • Synonyms: AEDL, Bronchial Peptide Bioregulator
Out of Stock
Cardiogen 20 mg - Peptide Sciences USA Research Peptides
Peptide Sciences USA
  • Active Substance: Cardiogen
  • Concentration: 20 mg per vial
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: Cardiogen
  • Molecular Formula: C18H31N7O9
  • Molecular Weight: 489.5 g/mol
  • Sequence: Ala-Glu-Asp-Arg
Out of Stock
Cartalax 20 mg - Peptide Sciences USA Research Peptides
Peptide Sciences USA
  • Active Substance: Cartalax
  • Concentration: 20 mg per vial
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: Cartalax
  • Molecular Formula: C12H19N3O8
  • Molecular Weight: 333.29 g/mol
  • Sequence: Ala-Glu-Asp
  • Synonyms: AED, T-31, SCHEMBL5324601
Out of Stock
Chonluten 20 mg - Peptide Sciences USA Research Peptides
Peptide Sciences USA
  • Active Substance: Chonluten
  • Concentration: 20 mg per vial
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: Chonluten
  • Molecular Formula: C11H17N3O8
  • Molecular Weight: 319.27 g/mol
  • Sequence: Glu-Asp-Gly
  • Synonyms: Tripeptide T-34, EDG, AC-7
Out of Stock
Cortagen 20 mg - Peptide Sciences USA Research Peptides
Peptide Sciences USA
  • Active Substance: Cortagen
  • Concentration: 20 mg per vial
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: Cortagen
  • Molecular Formula: C17H27N5O8
  • Molecular Weight: 430.17 g/mol
  • Sequence: Ala-Glu-Asp-Pro
  • Synonyms: AEDP, SCHEMBL5491754
Out of Stock
DSIP 5 mg - Peptide Sciences USA Research Peptides
Peptide Sciences USA
  • Active Substance: Delta-sleep-inducing peptide
  • Concentration: 5 mg per vial
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: DSIP
  • Molecular Formula: C35H48N10O15
  • Molecular Weight: 848.81 g/mol
  • Sequence: Trp-Ala-Gly-Gly-Asp-Ala-Ser-Gly-Glu
  • Synonyms: Delta-sleep-inducing peptide, WAGGDASGE
Out of Stock
Epitalon 3 mg Capsule - Peptide Sciences USA Research Peptides
Peptide Sciences USA
  • Active Substance: Epitalon
  • Concentration: 3 mg per capsule
  • Pack Size: 60 capsules
  • Manufacturer: Peptide Sciences USA
  • Brand Name: Epitalon
  • Molecular Formula: C14H22N4O9
  • Molecular Weight: 390.35 g/mol
  • Sequence: Ala-Glu-Asp-Gly
  • Synonyms: Epithalon, AEDG, Epithalamin analog
Out of Stock
Epithalon 50 mg - Peptide Sciences USA Research Peptides
Peptide Sciences USA
  • Active Substance: Epitalon
  • Concentration: 50 mg per vial
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: Epitalon
  • Molecular Formula: C14H22N4O9
  • Molecular Weight: 390.35 g/mol
  • Sequence: Ala-Glu-Asp-Gly
  • Synonyms: Epithalon, AEDG, Epithalamin analog
Out of Stock
FOX04-DRI 10 mg - Peptide Sciences USA Research Peptides
Peptide Sciences USA
  • Active Substance: Proxofim (FOXO4-D-Retro-Inverso)
  • Concentration: 10 mg per vial
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: Proxofim
  • Molecular Formula: C228H388N86O64
  • Molecular Weight: 5358.05 g/mol
  • Sequence: H-D-Leu-D-Thr-D-Leu-D-Arg-D-Lys-D-Glu-D-Pro-D-Ala-D-Ser-D-Glu-D-Ile-D-Ala-D-Gln-D-Ser-D-Ile-D-Leu-D-Glu-D-Ala-D-Tyr-D-Ser-D-Gln-D-Asn-D-Gly-D-Trp-D-Ala-D-Asn-D-Arg-D-Arg-D-Ser-D-Gly-D-Gly-D-Lys-D-Arg-D-Pro-D-Pro-D-Pro-D-Arg-D-Arg-D-Arg-D-Gln-D-Arg-D-Arg-D-Lys-D-Lys-D-Arg-D-Gly-OH
  • Synonyms: Forkhead box protein O4 D-Retro-Inverso, FOXO4a, AFX, AFX1, MLLT7
Out of Stock
GHK-Cu 2 mg - Peptide Sciences USA Research Peptides
Peptide Sciences USA
  • Active Substance: Glycyl-L-Histidyl-L-Lysine Copper Complex (GHK-Cu)
  • Concentration: 2 mg per capsule
  • Pack Size: 60 capsules
  • Manufacturer: Peptide Sciences USA
  • Brand Name: GHK-Cu
  • Categories: Oral Peptides, Immune & Longevity Support Peptides, Anti-Aging & Skin Health Peptides
  • Molecular Formula: C14H22N6O4Cu
  • Molecular Weight: ~403 g/mol
  • Sequence: Gly-His-Lys-Cu
  • Synonyms: Copper Tripeptide-1, GHK Copper Peptide
Out of Stock
GHK-Cu 200 mg - Peptide Sciences USA Research Peptides
Peptide Sciences USA
  • Active Substance: Glycyl-L-Histidyl-L-Lysine Copper Complex (GHK-Cu)
  • Concentration: 200 mg per container
  • Pack Size: Single container (lyophilized powder for topical formulation)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: GHK-Cu
  • Molecular Formula: C14H22N6O4Cu
  • Molecular Weight: ~403 g/mol
  • Sequence: Gly-His-Lys-Cu
  • Synonyms: Copper Tripeptide-1, GHK Copper Peptide
Out of Stock
GHK-Cu 50 mg - Peptide Sciences USA Research Peptides
Peptide Sciences USA
  • Active Substance: Glycyl-L-Histidyl-L-Lysine Copper Complex (GHK-Cu)
  • Concentration: 50 mg per vial
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: GHK-Cu
  • Molecular Formula: C14H22N6O4Cu
  • Molecular Weight: ~403 g/mol
  • Sequence: Gly-His-Lys-Cu
  • Synonyms: Copper Tripeptide-1, GHK Copper Peptide
Out of Stock
GHRP-6 10 mg - Peptide Sciences USA Research Peptides
Peptide Sciences USA
  • Active Substance: Growth Hormone-Releasing Peptide 6 (GHRP-6)
  • Concentration: 10 mg per vial
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: GHRP-6
  • Molecular Formula: C46H56N12O6
  • Molecular Weight: 873.01 g/mol
  • Sequence: His-D-Trp-Ala-Trp-D-Phe-Lys-NH2
  • Synonyms: Growth Hormone Secretagogue, GHRP-6
Out of Stock
LL-37 5 mg - Peptide Sciences USA Research Peptides
Peptide Sciences USA
  • Active Substance: LL-37 (Cathelicidin)
  • Concentration: 5 mg per vial
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: LL-37
  • Molecular Formula: C205H340N60O53
  • Molecular Weight: 4493.3 g/mol
  • Sequence: LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES
  • Synonyms: Cathelicidin, hCAP-18 (C-terminal)
Out of Stock
N-Acetyl Epithalon Amidate 20 mg - Peptide Sciences USA Research Peptides
Peptide Sciences USA
  • Active Substance: Acetyl-Epitalon-Amidate
  • Concentration: 20 mg per vial
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: Epitalon
  • Molecular Formula: C14H22N4O9
  • Molecular Weight: 446.45 g/mol
  • Sequence: Ac-Ala-Glu-Asp-Gly-NH2
  • Synonyms: N-Acetyl Epitalon, Epithalamin derivative, AEDG peptide
Out of Stock
N-Acetyl Selank Amidate 10 mg - Peptide Sciences USA Research Peptides
Peptide Sciences USA
  • Active Substance: N-Acetyl Selank Amidate
  • Concentration: 10 mg per vial
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: Tuftsin
  • Molecular Formula: C33H57N11O9
  • Molecular Weight: 751.89 g/mol
  • Sequence: Ac-Thr-Lys-Pro-Arg-Pro-Gly-Pro-NH2
  • Synonyms: N-Acetyl Selank, Selanc, TP-7
Out of Stock
N-Acetyl Semax Amidate 30 mg - Peptide Sciences USA Research Peptides
Peptide Sciences USA
  • Active Substance: Semax Heptapeptide (N-Acetyl, Amidate)
  • Concentration: 30 mg per vial
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: Semax
  • Molecular Formula: C37H51N9O10S
  • Molecular Weight: 813.92 g/mol
  • Sequence: Ac-Met-Glu-His-Phe-Pro-Gly-Pro-NH2
  • Synonyms: N-Acetyl Semax, NA-Semax Amidate, ACTH(4-10) analogue
Out of Stock
NAD+ 750 mg - Peptide Sciences USA Research Peptides
Peptide Sciences USA
  • Active Substance: Nicotinamide Adenine Dinucleotide (NAD+)
  • Concentration: 750 mg per vial
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: NAD
  • Molecular Formula: C21H27N7O14P2
  • Molecular Weight: 663.43 g/mol
  • Synonyms: Nicotinamide Adenine Dinucleotide, beta-NAD, Endopride
Out of Stock
Prostamax 20 mg - Peptide Sciences USA Research Peptides
Peptide Sciences USA
  • Active Substance: Prostamax (Khavinson Tetrapeptide)
  • Concentration: 20 mg per vial
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: Khavinson
  • Molecular Formula: C20H33N5O9
  • Molecular Weight: 487.5 g/mol
  • Sequence: Lys-Glu-Asp-Pro (KEDP)
  • Synonyms: KEDP, Prostamax Bioregulator
Out of Stock
Selank 30 mg - Peptide Sciences USA Research Peptides
Peptide Sciences USA
  • Active Substance: Selank Anxiolytic Peptide
  • Concentration: 30 mg per vial
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: Selank
  • Molecular Formula: C33H57N11O9
  • Molecular Weight: 751.9 g/mol
  • Sequence: Thr-Lys-Pro-Arg-Pro-Gly-Pro (TKPRPGP)
  • Synonyms: Selank, TP-7, Tuftsin Analog
Out of Stock
Selank 5 mg - Peptide Sciences USA Research Peptides
Peptide Sciences USA

Product Details

  • Active Substance: Selank Anxiolytic Peptide
  • Concentration: 5 mg per vial
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: Selank
  • Molecular Formula: C33H57N11O9
  • Molecular Weight: 751.9 g/mol
  • Sequence: Thr-Lys-Pro-Arg-Pro-Gly-Pro (TKPRPGP)
  • Synonyms: Selank, TP-7, Tuftsin Analog
Out of Stock
Semax 30 mg - Peptide Sciences USA Research Peptides
Peptide Sciences USA
  • Active Substance: Semax Heptapeptide
  • Concentration: 30 mg per vial
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: Semax
  • Molecular Formula: C37H51N9O10S
  • Molecular Weight: 813.92 g/mol
  • Sequence: Met-Glu-His-Phe-Pro-Gly-Pro (MEHFPGP)
  • Synonyms: Semax, ACTH(4-10) Analog, Pro-Gly-Pro-ACTH
Out of Stock
Semax 2 mg - Peptide Sciences USA Research Peptides
Peptide Sciences USA
  • Active Substance: Semax Heptapeptide
  • Concentration: 30 mg per vial
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: Semax
  • Molecular Formula: C37H51N9O10S
  • Molecular Weight: 813.92 g/mol
  • Sequence: Met-Glu-His-Phe-Pro-Gly-Pro (MEHFPGP)
  • Synonyms: Semax, ACTH(4-10) Analog, Pro-Gly-Pro-ACTH
Out of Stock
Semax 5 mg - Peptide Sciences USA Research Peptides
Peptide Sciences USA
  • Active Substance: Semax Heptapeptide
  • Concentration: 5 mg per vial
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: Semax
  • Molecular Formula: C37H51N9O10S
  • Molecular Weight: 813.92 g/mol
  • Sequence: Met-Glu-His-Phe-Pro-Gly-Pro (MEHFPGP)
  • Synonyms: Semax, ACTH(4-10) Analog, Pro-Gly-Pro-ACTH
Out of Stock
SLU-PP-332 - Peptide Sciences USA Research Peptides
Peptide Sciences USA
  • Active Substance: SLU-PP-332 (Pan-ERR Agonist)
  • Concentration: 1000 mcg per capsule
  • Pack Size: 30 capsules (30,000 mcg total)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: SLU-PP-332
  • Molecular Formula: Not fully disclosed (medium-length peptide)
  • Molecular Weight: 290.32 g/mol
  • Sequence: Proprietary (10–30 amino acids)
  • Synonyms: SLU-PP-332, ERR Agonist, Exercise Mimetic
Out of Stock
SS-31 25 mg - Peptide Sciences USA Research Peptides
Peptide Sciences USA
  • Active Substance: SS-31 Mitochondria-Targeting Peptide (Elamipretide)
  • Concentration: 25 mg per vial
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: Elamipretide
  • Molecular Formula: C32H49N9O5
  • Molecular Weight: 639.8 g/mol
  • Sequence: D-Arg-2,6-dimethylTyr-Lys-Phe-NH2
  • Synonyms: Elamipretide, Bendavia, MTP-131
Out of Stock
TB-500 2 mg - Peptide Sciences USA Research Peptides
Peptide Sciences USA
  • Active Substance: Thymosin Beta-4 (TB-500)
  • Concentration: 2 mg per vial
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: TB-500
  • Categories: Injectable Peptides, Healing & Recovery Peptides, Muscle Growth Peptides, Immune & Longevity Support Peptides
  • Molecular Formula: C212H350N56O78S
  • Molecular Weight: 4963.49 g/mol
  • Sequence: SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
  • Synonyms: Thymosin Beta-4, TB500
Out of Stock
TB-500 5 mg - Peptide Sciences USA Research Peptides
Peptide Sciences USA
  • Active Substance: Thymosin Beta-4 (TB-500)
  • Concentration: 5 mg per vial
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: TB-500
  • Molecular Formula: C212H350N56O78S
  • Molecular Weight: 4963.49 g/mol
  • Synonyms: Thymosin Beta-4, TB500
Out of Stock
TB-500 Fragment (17-23) 10 mg - Peptide Sciences USA Research Peptides
Peptide Sciences USA
  • Active Substance: TB-500 Fragment (17-23) (Fequesetide)
  • Concentration: 10 mg per vial
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: TB-500
  • Molecular Formula: C38H65N11O14
  • Molecular Weight: 889.0 g/mol
  • Sequence: Ac-LKKTETQ
  • Synonyms: TB-500 Fragment, Fequesetide, Thymosin Beta-4 (17-23)
Out of Stock
Tesamorelin 2 mg - Peptide Sciences USA Research Peptides
Peptide Sciences USA
  • Active Substance: Tesamorelin
  • Concentration: 2 mg per vial
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: Tesamorelin
  • Molecular Formula: C221H366N72O67S
  • Molecular Weight: 5135.89 g/mol
  • Sequence: H-His-D-Trp-Ala-Trp-D-Phe-Lys-Thr-Phe-Thr-Ser-Tyr-Ser-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-Ser-Arg-NH2
  • Synonyms: Egrifta, Growth Hormone-Releasing Factor (GHRF) Analog
Out of Stock
Testagen 20 mg - Peptide Sciences USA Research Peptides
Peptide Sciences USA
  • Active Substance: Testagen (Bioregulatory Tetrapeptide)
  • Concentration: 20 mg per vial
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: Testagen
  • Molecular Formula: C17H29N5O9
  • Molecular Weight: 447.2 g/mol
  • Sequence: Lys-Glu-Asp-Gly
  • Synonyms: Testagen, KEDG, Anterior Pituitary Peptide (APP)
Out of Stock
Thymagen 20 mg - Peptide Sciences USA Research Peptides
Peptide Sciences USA
  • Active Substance: Thymogen Alpha-1 (Glu-Trp, Lys-Glu)
  • Concentration: 20 mg per vial
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: Thymogen
  • Synonyms: Thymogen Alpha-1, Thymogen, Oglufanide
Out of Stock
Thymalin 20 mg - Peptide Sciences USA Research Peptides
Peptide Sciences USA
  • Active Substance: Thymogen Alpha-1 (Glu-Trp, Lys-Glu)
  • Concentration: 20 mg per vial
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: Thymogen
  • Molecular Formula (Thymogen): C16H19N3O5
  • Molecular Weight (Thymogen): 333.34 g/mol
  • Molecular Formula (Immune Peptide A2): C11H20N2O5
  • Molecular Weight (Immune Peptide A2): 260.29 g/mol
  • Sequence (Thymogen): Glu-Trp
  • Sequence (Immune Peptide A2): Lys-Glu
  • Synonyms: Thymogen Alpha-1, Thymogen, Oglufanide
Out of Stock
Thymalin 50 mg - Peptide Sciences USA Research Peptides
Peptide Sciences USA
  • Active Substance: Thymalin
  • Concentration: 50 mg per vial
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: Thymalin
  • Molecular Formula: Not fully defined – peptide complex derived from thymus extract
  • Molecular Weight: Approx. 900–1200 Da (varies)
  • Sequence: Peptide fractions with immune-regulatory activity (specific sequence not disclosed)
  • Synonyms: Thymus Extract Peptide, Thymic Peptide Complex
Out of Stock
Thymosin Alpha-1 10 mg - Peptide Sciences USA Research Peptides
Peptide Sciences USA
  • Active Substance: Thymosin Alpha-1
  • Concentration: 10 mg per vial
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: Thymosin
  • Molecular Formula: C129H215N33O55
  • Molecular Weight: 3108.3 g/mol
  • Synonyms: TA1, Zadaxin, Immune Modulator Peptide
Out of Stock
Showing 50 of 61 products

Immune & Longevity Peptides

Immune and longevity peptides are short-chain amino acid sequences explored for their effects on the endocrine system, immune balance, cellular lifespan, and epigenetic regulation. These peptides are often associated with bioregulation, meaning they help modulate homeostasis within aging or stressed biological systems. Researchers in the fields of anti-aging, immunotherapy, and cell repair are particularly interested in these compounds.

Top Peptides for Immunity and Longevity Research

BuyPeptides.net offers research-grade peptides that are commonly studied in immunological and aging-related models:

  • Epitalon – A synthetic tetrapeptide researched for its ability to activate telomerase and regulate pineal gland function
  • Thymalin – A thymus-derived peptide used in studies related to immune rebalancing and lifespan extension
  • Pinealon – A neuropeptide examined for cognitive protection, mitochondrial health, and anti-aging applications
  • Thymosin Alpha-1 (Tα1) – Explored for its immune-modulatory properties and potential use in infectious disease models

These peptides are typically administered via injection for experimental use and are labeled for research purposes only.

Benefits of Longevity Peptides in Research

Longevity peptides are particularly useful for researchers examining the intersection of immune function, endocrine regulation, and biological aging. These peptides may work through mechanisms such as gene expression modulation, oxidative stress reduction, and thymic rejuvenation.

Common research applications include:

  • Slowing of telomere shortening and chromosomal degradation
  • Boosting thymic function in immune-deficient models
  • Neuroprotection in aging-related cognitive decline
  • Systemic support for oxidative stress and inflammation reduction

Due to their mild nature and targeted action, these peptides are frequently included in long-term regenerative research protocols.

Why Buy Longevity Peptides from Research-Peptides.com?

At BuyPeptides, we offer only premium peptides sourced from trusted, GMP-compliant laboratories. Our selection includes rare bioregulators and peptide analogs used in aging, immunity, and performance-based research. We ship globally, store under controlled conditions, and provide clear documentation for every product.

When ordering from us, you'll receive:

  • Research-grade quality with batch testing and COAs
  • Fast international shipping and secure packaging
  • Exclusive compounds not widely available from competitors
  • Expert support if you need guidance in product selection

All immune and longevity peptides are sold for research use only. They are not approved for human or veterinary use. If you're conducting advanced studies in bioregulation, aging biology, or immunology, this category provides the tools to drive your research forward.

Menu
Account Cart