Home
About Us
FAQs
Articles
Contacts
News
Hello, Log In My Account
Shopping Cart $0.00
Subtotal $0.00
Shipping $0.00
Total $0.00
View Cart Checkout

Healing & Recovery Peptides

Support your tissue regeneration, inflammation, and recovery studies with our curated range of healing peptides. These compounds are widely used in research focused on muscle repair, wound healing, and systemic recovery. Featuring trusted molecules like BPC-157, TB-500, and GHK-Cu, our healing peptides are trusted by professionals for performance and therapeutic research.
Shop now and strengthen your healing studies with verified peptides.

Filters

Filters

$ – $
Showing 50 of 66 products
Image
SKU
Product
Rating
Price
AOD 9604 5 mg - Dragon Pharma Research Peptides
Dragon Pharma

  • Active Substance: Anti-Obesity Drug-9604 (AOD 9604)
  • Concentration: 5 mg per vial
  • Pack Size: Lyophilized vial for injection-based research
  • Manufacturer: Dragon Pharma
  • Brand Name: AOD9604
  • Molecular Formula: C78H123N23O23S
  • Molecular Weight: 1815.1 g/mol
  • Sequence: Tyr-Leu-Arg-Ile-Val-Gln-Cys-Arg-Ser-Val-Glu-Gly-Ser-Cys-Gly-Phe
  • Synonyms: hGH 176–191 fragment, Fat Loss Peptide, Lipolytic GH Fragment
$75.00
BPC 157 - Dragon Pharma Research Peptides
Dragon Pharma
  • Active Substance: BPC-157 Pentadecapeptide
  • Concentration: 2 mg per vial
  • Pack Size: 1 vial (lyophilized powder)
  • Manufacturer: Dragon Pharma
  • Brand Name: BPC 157
  • Molecular Formula: C62H98N16O22
  • Molecular Weight: 1419.55 g/mol
  • Sequence: Gly-Glu-Pro-Pro-Pro-Gly-Lys-Pro-Ala-Asp-Asp-Ala-Gly-Leu-Val
  • Synonyms: Body Protection Compound-157, PL 14736
$80.00
IGF-1 LR3 - Dragon Pharma Research Peptides
Dragon Pharma
  • Active Substance: Insulin-like Growth Factor 1, Long R3 (IGF-1 LR3)
  • Concentration: 1 mg per vial
  • Pack Size: Lyophilized injectable vial
  • Manufacturer: Dragon Pharma
  • Brand Name: IGF-1 LR3
  • Molecular Formula: C400H625N111O115S6
  • Molecular Weight: ~9111 Da
  • Synonyms: Long R3 IGF-1, LR3 IGF-1, IGF1 analogue
$90.00
Ipamorelin - Dragon Pharma Research Peptides
Dragon Pharma
  • Active Substance: Ipamorelin
  • Concentration: 5 mg per vial
  • Pack Size: Lyophilized injectable vial
  • Manufacturer: Dragon Pharma
  • Brand Name: Ipamorelin
  • Molecular Formula: C38H49N9O5
  • Molecular Weight: 711.85 g/mol
  • Synonyms: IPAM, Growth Hormone Releasing Peptide-5, GHRP-5
$45.00
LGD 4033 - Dragon Pharma Research Peptides
Dragon Pharma
  • Active Substance: Ligandrol (LGD 4033)
  • Concentration: 15 mg per tablet
  • Pack Size: 100 tablets per bottle
  • Manufacturer: Dragon Pharma
  • Brand Name: Ligandrol
  • Molecular Formula: C14H12F6N2O
  • Molecular Weight: 338.25 g/mol
  • Synonyms: LGD-4033, VK5211, Ligandrol
$95.00
MK 677 (Ibutamoren) - Dragon Pharma Research Peptides
Dragon Pharma
  • Active Substance: Ibutamoren (MK-677)
  • Concentration: 25 mg per tablet
  • Pack Size: 100 tablets per bottle
  • Manufacturer: Dragon Pharma
  • Brand Name: Ibutamoren
  • Molecular Formula: C27H36N4O5S
  • Molecular Weight: 528.66 g/mol
  • Synonyms: MK-677, Ibutamoren mesylate, Nutrobal
$175.00
Sermorelin - Dragon Pharma Research Peptides
Dragon Pharma
  • Active Substance: Sermorelin
  • Concentration: 5 mg per vial
  • Pack Size: 1 vial (lyophilized powder)
  • Manufacturer: Dragon Pharma
  • Brand Name: Sermorelin
  • Molecular Formula: C149H246N44O42
  • Molecular Weight: 3357.89 g/mol
  • Sequence: Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg
  • Synonyms: GHRH(1-29), Growth Hormone Releasing Hormone fragment, Sermorelin Acetate
$45.00
TB 500 - Dragon Pharma Research Peptides
Dragon Pharma
  • Active Substance: Thymosin Beta 4 (TB 500)
  • Concentration: 5 mg per vial
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Dragon Pharma
  • Brand Name: TB 500
  • Molecular Formula: C212H350N56O78S
  • Molecular Weight: 4963.49 g/mol
  • Synonyms: TB500, Thymosin Beta-4 Fragment, Fequesetide
$55.00
BPC-157 10 mg - Peptide Sciences USA Research Peptides
Peptide Sciences USA
  • Active Substance: BPC-157 Pentadecapeptide
  • Concentration: 10 mg per vial
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: BPC 157
  • Molecular Formula: C62H98N16O22
  • Molecular Weight: 1419.54 g/mol
  • Sequence: Gly-Glu-Pro-Pro-Pro-Gly-Lys-Pro-Ala-Pro-Pro-Ala-Glu-Gly-Lys
  • Synonyms: Body Protection Compound-157, Pentadecapeptide BPC
Out of Stock
BPC-157 5 mg - Peptide Sciences USA Research Peptides
Peptide Sciences USA
  • Active Substance: BPC-157 Pentadecapeptide
  • Concentration: 5 mg per vial
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: BPC 157
  • Molecular Formula: C62H98N16O22
  • Molecular Weight: 1419.54 g/mol
  • Sequence: Gly-Glu-Pro-Pro-Pro-Gly-Lys-Pro-Ala-Pro-Pro-Ala-Glu-Gly-Lys
  • Synonyms: Body Protection Compound-157, Pentadecapeptide BPC
Out of Stock
BPC-157/TB-500 10 mg Blend - Peptide Sciences USA Research Peptides
Peptide Sciences USA
  • Active Substance: Thymosin beta 4 / Pentadecapeptide (5 mg BPC-157 + 5 mg TB-500)
  • Concentration: 10 mg per vial (5 mg each peptide)
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: Peptide Blend
  • Molecular Formula (BPC-157): C62H98N16O22
  • Molecular Weight (BPC-157): 1419.54 g/mol
  • Sequence (BPC-157): Gly-Glu-Pro-Pro-Pro-Gly-Lys-Pro-Ala-Pro-Pro-Ala-Glu-Gly-Lys
  • Molecular Formula (TB-500): C38H68N10O14
  • Molecular Weight (TB-500): 889.01 g/mol
  • Sequence (TB-500): Ac-LKKTETQ
  • Synonyms: BPC-157 (Body Protection Compound-157), TB-500 (Thymosin Beta-4 fragment)
Out of Stock
BPC-157/TB-500 20 mg Blend - Peptide Sciences USA Research Peptides
Peptide Sciences USA
  • Active Substance: Thymosin beta 4 / Pentadecapeptide (10 mg BPC-157 + 10 mg TB-500)
  • Concentration: 20 mg per vial (10 mg each peptide)
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Molecular Formula (BPC-157): C62H98N16O22
  • Molecular Weight (BPC-157): 1419.54 g/mol
  • Sequence (BPC-157): Gly-Glu-Pro-Pro-Pro-Gly-Lys-Pro-Ala-Pro-Pro-Ala-Glu-Gly-Lys
  • Molecular Formula (TB-500): C38H68N10O14
  • Molecular Weight (TB-500): 889.01 g/mol
  • Sequence (TB-500): Ac-LKKTETQ
  • Synonyms: BPC-157 (Body Protection Compound-157), TB-500 (Thymosin Beta-4 fragment)
Out of Stock
BPC-157/TB-500/GHK-Cu 30 mg - Peptide Sciences USA Research Peptides
Peptide Sciences USA
  • Active Substance: Thymosin beta 4 / Pentadecapeptide / GHK-Cu (10 mg BPC-157 + 10 mg TB-500 + 10 mg GHK-Cu)
  • Concentration: 30 mg per vial (10 mg each peptide)
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: Peptide Blend
  • Molecular Formula (BPC-157): C62H98N16O22
  • Molecular Weight (BPC-157): 1419.54 g/mol
  • Sequence (BPC-157): Gly-Glu-Pro-Pro-Pro-Gly-Lys-Pro-Ala-Pro-Pro-Ala-Glu-Gly-Lys
  • Molecular Formula (TB-500): C38H68N10O14
  • Molecular Weight (TB-500): 889.01 g/mol
  • Sequence (TB-500): Ac-LKKTETQ
  • Molecular Formula (GHK-Cu): C14H24CuN6O4
  • Molecular Weight (GHK-Cu): 340.87 g/mol (excluding copper)
  • Sequence (GHK-Cu): Glycyl-Histidyl-Lysine
  • Synonyms: BPC-157 (Body Protection Compound-157), TB-500 (Thymosin Beta-4 fragment), GHK-Cu (Copper Tripeptide-1)
Out of Stock
CJC-1295 (No DAC) / Ipamorelin 10 mg - Peptide Sciences USA Research Peptides
Peptide Sciences USA
  • Active Substance: Duo-Blend CJC-1295 No DAC and Ipamorelin (5 mg each)
  • Concentration: 10 mg per vial (5 mg CJC-1295 No DAC + 5 mg Ipamorelin)
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: Peptide Blend
  • Molecular Formula (CJC-1295 No DAC): C152H252N44O42
  • Molecular Weight (CJC-1295 No DAC): 3367.97 g/mol
  • Sequence (CJC-1295 No DAC): H-Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-Ser-Arg-NH2
  • Molecular Formula (Ipamorelin): C38H49N9O5
  • Molecular Weight (Ipamorelin): 711.85 g/mol
  • Sequence (Ipamorelin): Aib-His-D-2-Nal-D-Phe-Lys-NH2
  • Synonyms: CJC-1295 No DAC (Modified GRF 1-29, Sermorelin analog), Ipamorelin (GHRP, Ghrelin mimetic)
Out of Stock
CJC-1295 / GHRP-6 10 mg - Peptide Sciences USA Research Peptides
Peptide Sciences USA
  • Product Title: CJC-1295 / GHRP-2 10 mg
  • Active Substance: Tetrasubstituted 30-Amino Acid Peptide Hormone / Growth Hormone-Releasing Peptide 2 (5 mg CJC-1295 No DAC + 5 mg GHRP-2)
  • Concentration: 10 mg per vial (5 mg each peptide)
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: Peptide Blend
  • Molecular Formula (CJC-1295 No DAC): C152H252N44O42
  • Molecular Weight (CJC-1295 No DAC): 3367.97 g/mol
  • Sequence (CJC-1295 No DAC): H-Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-Ser-Arg-NH2
  • Molecular Formula (GHRP-2): C45H55N9O6
  • Molecular Weight (GHRP-2): 818.0 g/mol
  • Sequence (GHRP-2): D-Ala-D-2-Nal-Ala-Trp-D-Phe-Lys-NH2
  • Synonyms: CJC-1295 No DAC (Modified GRF 1-29, Sermorelin analog), GHRP-2 (Pralmorelin, Growth Hormone-Releasing Peptide-2)
Out of Stock
CJC-1295 / Hexarelin 10 mg - Peptide Sciences USA Research Peptides
Peptide Sciences USA
  • Product Title: CJC-1295 / Hexarelin 10 mg
  • Active Substance: Duo-Blend CJC-1295 No DAC and Hexarelin (5 mg each)
  • Concentration: 10 mg per vial (5 mg CJC-1295 No DAC + 5 mg Hexarelin)
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: Peptide Blend
  • Molecular Formula (CJC-1295 No DAC): C152H252N44O42
  • Molecular Weight (CJC-1295 No DAC): 3367.97 g/mol
  • Sequence (CJC-1295 No DAC): H-Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-Ser-Arg-NH2
  • Molecular Formula (Hexarelin): C47H58N12O6
  • Molecular Weight (Hexarelin): 887.04 g/mol
  • Sequence (Hexarelin): His-D-2-methyl-Trp-Ala-Trp-D-Phe-Lys-NH2
  • Synonyms: CJC-1295 No DAC (Modified GRF 1-29, Sermorelin analog), Hexarelin (Examorelin, Growth Hormone-Releasing Hexapeptide)
Out of Stock
CJC-1295 no DAC 2 mg - Peptide Sciences USA Research Peptides
Peptide Sciences USA
  • Active Substance: CJC-1295 No DAC
  • Concentration: 2 mg per vial
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: Mod GRF (1-29)
  • Molecular Formula: C152H252N44O42
  • Molecular Weight: 3367.97 g/mol
  • Sequence: H-Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-Ser-Arg-NH2
  • Synonyms: Modified GRF (1-29), Sermorelin analog
Out of Stock
CJC1295 / Ipamorelin / GHRP-2 - Peptide Sciences USA Research Peptides
Peptide Sciences USA
  • Active Substance: CJC-1295 DAC / Ipamorelin / GHRP-2 (3 mg each)
  • Concentration: 9 mg per vial (3 mg CJC-1295 DAC + 3 mg Ipamorelin + 3 mg GHRP-2)
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: Peptide Blend
  • Molecular Formula (CJC-1295 DAC): C152H252N44O42 (with DAC modification)
  • Molecular Weight (CJC-1295 DAC): ~3367.97 g/mol
  • Sequence (CJC-1295 DAC): H-Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-Ser-Arg-Lys(Maleimidopropionyl)-NH2
  • Molecular Formula (Ipamorelin): C38H49N9O5
  • Molecular Weight (Ipamorelin): 711.85 g/mol
  • Sequence (Ipamorelin): Aib-His-D-2-Nal-D-Phe-Lys-NH2
  • Molecular Formula (GHRP-2): C45H55N9O6
  • Molecular Weight (GHRP-2): 818.0 g/mol
  • Sequence (GHRP-2): D-Ala-D-2-Nal-Ala-Trp-D-Phe-Lys-NH2
  • Synonyms: CJC-1295 DAC (DAC:GRF), Ipamorelin (GHRP, Ghrelin mimetic), GHRP-2 (Pralmorelin)
Out of Stock
Duo-Blend Mod GRF / GHRP-2 10 mg - Peptide Sciences USA Research Peptides
Peptide Sciences USA
  • Active Substance: Modified GRF (CJC-1295 No DAC) and GHRP-2 (5 mg each)
  • Concentration: 10 mg per vial (5 mg Mod GRF + 5 mg GHRP-2)
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: Peptide Blend
  • Molecular Formula (Mod GRF): C152H252N44O42
  • Molecular Weight (Mod GRF): 3367.97 g/mol
  • Sequence (Mod GRF): H-Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-Ser-Arg-NH2
  • Molecular Formula (GHRP-2): C45H55N9O6
  • Molecular Weight (GHRP-2): 818.0 g/mol
  • Sequence (GHRP-2): D-Ala-D-2-Nal-Ala-Trp-D-Phe-Lys-NH2
  • Synonyms: Mod GRF (CJC-1295 No DAC, Sermorelin analog), GHRP-2 (Pralmorelin)
Out of Stock
Duo-Blend Mod GRF / GHRP-6 10 mg - Peptide Sciences USA Research Peptides
Peptide Sciences USA
  • Active Substance: Modified GRF (CJC-1295 No DAC) and GHRP-6 (5 mg each)
  • Concentration: 10 mg per vial (5 mg Mod GRF + 5 mg GHRP-6)
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: Peptide Blend
  • Molecular Formula (Mod GRF): C152H252N44O42
  • Molecular Weight (Mod GRF): 3367.97 g/mol
  • Sequence (Mod GRF): H-Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-Ser-Arg-NH2
  • Molecular Formula (GHRP-6): C46H56N12O6
  • Molecular Weight (GHRP-6): 873.01 g/mol
  • Sequence (GHRP-6): His-D-Trp-Ala-Trp-D-Phe-Lys-NH2
  • Synonyms: Mod GRF (CJC-1295 No DAC, Sermorelin analog), GHRP-6 (Growth Hormone-Releasing Hexapeptide)
Out of Stock
Duo-Blend Mod GRF / Ipamorelin 10 mg - Peptide Sciences USA Research Peptides
Peptide Sciences USA
  • Active Substance: Modified GRF (CJC-1295 No DAC) and Ipamorelin (5 mg each)
  • Concentration: 10 mg per vial (5 mg Mod GRF + 5 mg Ipamorelin)
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: Peptide Blend
  • Molecular Formula (Mod GRF): C152H252N44O42
  • Molecular Weight (Mod GRF): 3367.97 g/mol
  • Sequence (Mod GRF): H-Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-Ser-Arg-NH2
  • Molecular Formula (Ipamorelin): C38H49N9O5
  • Molecular Weight (Ipamorelin): 711.85 g/mol
  • Sequence (Ipamorelin): Aib-His-D-2-Nal-D-Phe-Lys-NH2
  • Synonyms: Mod GRF (CJC-1295 No DAC, Sermorelin analog), Ipamorelin (GHRP, Ghrelin mimetic)
Out of Stock
Duo-Blend Sermorelin / GHRP-2 10 mg - Peptide Sciences USA Research Peptides
Peptide Sciences USA
  • Active Substance: Sermorelin (Mod GRF, GHRH 1-29) and GHRP-2 (5 mg each)
  • Concentration: 10 mg per vial (5 mg Sermorelin + 5 mg GHRP-2)
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: Peptide Blend
  • Molecular Formula (Sermorelin): C149H246N44O42S
  • Molecular Weight (Sermorelin): 3357.93 g/mol
  • Sequence (Sermorelin): Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-NH2
  • Molecular Formula (GHRP-2): C45H55N9O6
  • Molecular Weight (GHRP-2): 818.0 g/mol
  • Sequence (GHRP-2): D-Ala-D-2-Nal-Ala-Trp-D-Phe-Lys-NH2
  • Synonyms: Sermorelin (GHRH 1-29, Mod GRF), GHRP-2 (Pralmorelin)
Out of Stock
Duo-Blend Sermorelin / GHRP-6 10 mg - Peptide Sciences USA Research Peptides
Peptide Sciences USA
  • Active Substance: Sermorelin (GHRH 1-29) and GHRP-6 (5 mg each)
  • Concentration: 10 mg per vial (5 mg Sermorelin + 5 mg GHRP-6)
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: Peptide Blend
  • Molecular Formula (Sermorelin): C149H246N44O42S
  • Molecular Weight (Sermorelin): 3357.93 g/mol
  • Sequence (Sermorelin): Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-NH2
  • Molecular Formula (GHRP-6): C46H56N12O6
  • Molecular Weight (GHRP-6): 873.01 g/mol
  • Sequence (GHRP-6): His-D-Trp-Ala-Trp-D-Phe-Lys-NH2
  • Synonyms: Sermorelin (GHRH 1-29, Mod GRF), GHRP-6 (Growth Hormone-Releasing Hexapeptide)
Out of Stock
Duo-Blend Tesamorelin / Ipamorelin 8 mg - Peptide Sciences USA Research Peptides
Peptide Sciences USA
  • Active Substance: Tesamorelin (6 mg) and Ipamorelin (2 mg)
  • Concentration: 8 mg per vial (6 mg Tesamorelin + 2 mg Ipamorelin)
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: Peptide Blend
  • Molecular Formula (Tesamorelin): C221H366N72O67S
  • Molecular Weight (Tesamorelin): 5135.86 g/mol
  • Sequence (Tesamorelin): Unk-Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-Gln-Gln-Gly-Glu-Ser-Asn-Gln-Glu-Arg-Gly-Ala-Arg-Ala-Arg-Leu-NH2
  • Molecular Formula (Ipamorelin): C38H49N9O5
  • Molecular Weight (Ipamorelin): 711.85 g/mol
  • Sequence (Ipamorelin): Aib-His-D-2-Nal-D-Phe-Lys-NH2
  • Synonyms: Tesamorelin (Egrifta, TH9507), Ipamorelin (GHRP, Ghrelin mimetic)
Out of Stock
Fragment / Modified GRF / Ipamorelin 12 mg - Peptide Sciences USA Research Peptides
Peptide Sciences USA
  • Active Substance: HGH Fragment 176-191 (6 mg), Modified GRF (CJC-1295 No DAC, 3 mg), Ipamorelin (3 mg)
  • Concentration: 12 mg per vial (6 mg HGH Fragment 176-191 + 3 mg Modified GRF + 3 mg Ipamorelin)
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: Peptide Blend
  • Molecular Formula (HGH Fragment 176-191): C78H125N24O24S2
  • Molecular Weight (HGH Fragment 176-191): 1817.12 g/mol
  • Sequence (HGH Fragment 176-191): Tyr-Leu-Arg-Ile-Val-Gln-Cys-Arg-Ser-Val-Glu-Gly-Ser-Cys-Gly-Phe
  • Molecular Formula (Modified GRF): C152H252N44O42
  • Molecular Weight (Modified GRF): 3367.97 g/mol
  • Sequence (Modified GRF): H-Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-Ser-Arg-NH2
  • Molecular Formula (Ipamorelin): C38H49N9O5
  • Molecular Weight (Ipamorelin): 711.85 g/mol
  • Sequence (Ipamorelin): Aib-His-D-2-Nal-D-Phe-Lys-NH2
  • Synonyms: HGH Fragment 176-191 (AOD9604), Modified GRF (CJC-1295 No DAC), Ipamorelin (GHRP, Ghrelin mimetic)
Out of Stock
Fragment / CJC1295 / Ipamorelin 12 mg - Peptide Sciences USA Research Peptides
Peptide Sciences USA
  • Active Substance: HGH Fragment 176-191 (6 mg), CJC1295 No DAC (3 mg), Ipamorelin (3 mg)
  • Concentration: 12 mg per vial (6 mg HGH Fragment 176-191 + 3 mg CJC1295 + 3 mg Ipamorelin)
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: Peptide Blend
  • Molecular Formula (HGH Fragment 176-191): C78H125N24O24S2
  • Molecular Weight (HGH Fragment 176-191): 1817.12 g/mol
  • Sequence (HGH Fragment 176-191): Tyr-Leu-Arg-Ile-Val-Gln-Cys-Arg-Ser-Val-Glu-Gly-Ser-Cys-Gly-Phe
  • Molecular Formula (CJC1295 No DAC): C152H252N44O42
  • Molecular Weight (CJC1295 No DAC): 3367.97 g/mol
  • Sequence (CJC1295 No DAC): H-Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-Ser-Arg-NH2
  • Molecular Formula (Ipamorelin): C38H49N9O5
  • Molecular Weight (Ipamorelin): 711.85 g/mol
  • Sequence (Ipamorelin): Aib-His-D-2-Nal-D-Phe-Lys-NH2
  • Synonyms: HGH Fragment 176-191 (AOD9604), CJC1295 No DAC (Mod GRF), Ipamorelin (GHRP, Ghrelin mimetic)
Out of Stock
GHK-Cu 500 mg - Peptide Sciences USA Research Peptides
Peptide Sciences USA
  • Active Substance: Glycyl-L-Histidyl-L-Lysine Copper Complex (GHK-Cu)
  • Concentration: 500 mg per container
  • Pack Size: Single container (lyophilized powder for topical formulation)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: GHK-Cu
  • Molecular Formula: C14H22N6O4Cu
  • Molecular Weight: ~403 g/mol
  • Sequence: Gly-His-Lys-Cu
  • Synonyms: Copper Tripeptide-1, GHK Copper Peptide
Out of Stock
GHRH 5 mg - Peptide Sciences USA Research Peptides
Peptide Sciences USA
  • Active Substance: Growth Hormone–Releasing Hormone (Sermorelin analog)
  • Concentration: 5 mg per vial
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: Somatoliberin
  • Molecular Formula: C149H246N44O42S
  • Molecular Weight: 3357.93 g/mol
  • Sequence: Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-NH2
  • Synonyms: Somatoliberin, Sermorelin, GHRH 1-29
Out of Stock
GHRP-2 5 mg - Peptide Sciences USA Research Peptides
Peptide Sciences USA
  • Active Substance: Growth Hormone-Releasing Peptide 2 (GHRP-2)
  • Concentration: 5 mg per vial
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: GHRP-2
  • Molecular Formula: C45H55N9O6
  • Molecular Weight: 818.0 g/mol
  • Sequence: D-Ala-D-2-Nal-Ala-Trp-D-Phe-Lys-NH2
  • Synonyms: Pralmorelin, Growth Hormone Secretagogue
Out of Stock
Gonadorelin 10 mg - Peptide Sciences USA Research Peptides
Peptide Sciences USA
  • Active Substance: Gonadotropin-Releasing Hormone (Gonadorelin)
  • Concentration: 10 mg per vial
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: Gonadorelin
  • Molecular Formula: C55H75N17O13
  • Molecular Weight: 1182.29 g/mol
  • Sequence: pGlu-His-Trp-Ser-Tyr-Gly-Leu-Arg-Pro-Gly-NH2
  • Synonyms: GnRH, LHRH, Gonadotropin-Releasing Hormone
Out of Stock
Gut Inflammation - Peptide Sciences USA Research Peptides
Peptide Sciences USA
  • Active Substances: Stable BPC-157 (Arginate Salt, 500 mcg), KPV (500 mcg), PEA (400 mg), Tributyrin (400 mg)
  • Concentration: 801 mg per capsule
  • Pack Size: 60 capsules
  • Manufacturer: Peptide Sciences USA
  • Brand Name: Peptide Blend
  • Molecular Formulas: BPC-157 (C62H98N16O22), KPV (C16H30N4O4), PEA (C18H37NO2), Tributyrin (C15H26O6)
  • Molecular Weights: BPC-157 (~1419 g/mol), KPV (342.43 g/mol), PEA (299.49 g/mol), Tributyrin (302.36 g/mol)
Out of Stock
Hexarelin 5 mg - Peptide Sciences USA Research Peptides
Peptide Sciences USA
  • Active Substance: Hexarelin
  • Concentration: 5 mg per vial
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: Hexarelin
  • Molecular Formula: C47H58N12O6
  • Molecular Weight: 887.04 g/mol
  • Sequence: His-D-2-Me-Trp-Ala-Trp-D-Phe-Lys-NH2
  • Synonyms: Growth Hormone Secretagogue, Examorelin
Out of Stock
IGF-1-LR3 1 mg - Peptide Sciences USA Research Peptides
Peptide Sciences USA
  • Active Substance: Insulin-like Growth Factor 1, Long R3
  • Concentration: 1 mg per vial
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: IGF-1 LR3
  • Molecular Formula: C400H625N111O115S9
  • Molecular Weight: 9117.5 g/mol
  • Sequence: MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
  • Synonyms: Long R3 IGF-1, LR3-IGF-1
Out of Stock
Ipamorelin 10 mg - Peptide Sciences USA Research Peptides
Peptide Sciences USA
  • Active Substance: Ipamorelin
  • Concentration: 10 mg per vial
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: Ipamorelin
  • Molecular Formula: C38H49N9O5
  • Molecular Weight: 711.85 g/mol
  • Sequence: Aib-His-D-2-Nal-D-Phe-Lys-NH2
  • Synonyms: Growth Hormone Secretagogue, GHRP
Out of Stock
KPV 5 mg - Peptide Sciences USA Research Peptides
Peptide Sciences USA
  • Active Substance: Lysine-Proline-Valine (KPV)
  • Concentration: 5 mg per vial
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: KPV
  • Molecular Formula: C16H30N4O4
  • Molecular Weight: 342.43 g/mol
  • Sequence: Lys-Pro-Val
  • Synonyms: α-MSH(11-13), Melanocortin Tripeptide
Out of Stock
LL-37 5 mg - Peptide Sciences USA Research Peptides
Peptide Sciences USA
  • Active Substance: LL-37 (Cathelicidin)
  • Concentration: 5 mg per vial
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: LL-37
  • Molecular Formula: C205H340N60O53
  • Molecular Weight: 4493.3 g/mol
  • Sequence: LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES
  • Synonyms: Cathelicidin, hCAP-18 (C-terminal)
Out of Stock
MGF IGF-1 Ec 5 mg - Peptide Sciences USA Research Peptides
Peptide Sciences USA
  • Active Substance: Mechano Growth Factor (IGF-1Ec)
  • Concentration: 5 mg per vial
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: MGF
  • Molecular Formula: C124H204N42O41S1
  • Molecular Weight: 2971.99 g/mol
  • Sequence: Tyr-Gln-Pro-Pro-Ser-Thr-Asn-Lys-Asn-Thr-Lys-Ser-Gln-Arg-Arg-Lys-Gly-Ser-Thr-Phe-Glu-Glu-Arg-Lys-Cys
  • Synonyms: Mechano Growth Factor, IGF-1Eb, MGF-24aa-E
Out of Stock
MK-677 (Ibutamoren) 12.5 mg - Peptide Sciences USA Research Peptides
Peptide Sciences USA
  • Active Substance: Ibutamoren (MK-677)
  • Concentration: 12.5 mg per capsule
  • Pack Size: 60 capsules
  • Manufacturer: Peptide Sciences USA
  • Brand Name: Ibutamoren
  • Molecular Formula: C27H36N4O5S
  • Molecular Weight: 528.7 g/mol
  • Synonyms: MK-0677, Oratrope, L-163,191
Out of Stock
MOTS-c 10 mg - Peptide Sciences USA Research Peptides
Peptide Sciences USA
  • Active Substance: MOTS-c (Mitochondrial-Derived Peptide)
  • Concentration: 10 mg per vial
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: MOTS-c
  • Molecular Formula: C74H115N23O23S2
  • Molecular Weight: 1718.97 g/mol
  • Sequence: Met-Arg-Trp-Gln-Glu-Met-Gly-Tyr-Ile-Phe-Tyr-Pro-Arg-Lys-Leu-Arg
  • Synonyms: Mitochondrial ORF of the 12S rRNA-c, MDP
Out of Stock
MOTS-c 5 mg - Peptide Sciences USA Research Peptides
Peptide Sciences USA
  • Active Substance: MOTS-c (Mitochondrial-Derived Peptide)
  • Concentration: 5 mg per vial
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: MOTS-c
  • Molecular Formula: C74H115N23O23S2
  • Molecular Weight: 1718.97 g/mol
  • Sequence: Met-Arg-Trp-Gln-Glu-Met-Gly-Tyr-Ile-Phe-Tyr-Pro-Arg-Lys-Leu-Arg
  • Synonyms: Mitochondrial ORF of the 12S rRNA-c, MDP
Out of Stock
N-Acetyl Selank Amidate 10 mg - Peptide Sciences USA Research Peptides
Peptide Sciences USA
  • Active Substance: N-Acetyl Selank Amidate
  • Concentration: 10 mg per vial
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: Tuftsin
  • Molecular Formula: C33H57N11O9
  • Molecular Weight: 751.89 g/mol
  • Sequence: Ac-Thr-Lys-Pro-Arg-Pro-Gly-Pro-NH2
  • Synonyms: N-Acetyl Selank, Selanc, TP-7
Out of Stock
PE-22-28 - Peptide Sciences USA Research Peptides
Peptide Sciences USA
  • Active Substance: PE-22-28 (Spadin Derivative)
  • Concentration: 8 mg per vial
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: PE-22-28
  • Molecular Formula: C35H55N11O9
  • Molecular Weight: ~797.9 g/mol (estimated)
  • Sequence: Gly-Val-Ser-Trp-Gly-Leu-Arg-OH
  • Synonyms: Spadin Analog, TREK-1 Inhibitor
Out of Stock
PEG MGF 5 mg - Peptide Sciences USA Research Peptides
Peptide Sciences USA
  • Active Substance: Pegylated Mechano Growth Factor (PEG MGF)
  • Concentration: 5 mg per vial
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: PEG MGF
  • Molecular Formula: C121H200N42O39
  • Molecular Weight: ~2971.99 g/mol
  • Sequence: PEG-Suc-Tyr-Gln-Pro-Pro-Ser-Thr-Asn-Lys-Asn-Thr-Lys-Ser-Gln-Arg-Arg-Lys-Gly-Ser-Thr-Phe-Glu-Glu-Arg-Lys-Cys
  • Synonyms: Pegylated MGF, PEG IGF-1Ec, PEG Myotrophin
Out of Stock
PNC-27 5 mg - Peptide Sciences USA Research Peptides
Peptide Sciences USA
  • Active Substance: PNC-27 Anti-Cancer Peptide
  • Concentration: 5 mg per vial
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: PNC-27
  • Molecular Formula: C188H293N53O44S
  • Molecular Weight: 4031.7 g/mol
  • Sequence: PPLSQETFSDLWKLL-KKWKMRRNQFWVKVQRG
  • Synonyms: PNC-27 Peptide, p53 12-26 Penetratin
Out of Stock
Repair and Recovery - Peptide Sciences USA Research Peptides
Peptide Sciences USA
  • Active Substances: Thymosin Beta 4 Fragment (Ac-SDKP), Stable BPC-157 Arginate
  • Concentration: 3 mg per capsule (250 mcg BPC-157 Arginate, 2.5 mg Ac-SDKP)
  • Pack Size: 60 capsules
  • Manufacturer: Peptide Sciences USA
  • Brand Name: Peptide Blend
  • Molecular Formula (BPC-157 Arginate): C62H98N16O22
  • Molecular Weight (BPC-157 Arginate): 1419 g/mol
  • Sequence (BPC-157 Arginate): Gly-Glu-Pro-Pro-Pro-Gly-Lys-Pro-Ala-Asp-Asp-Ala-Gly-Leu-Val
  • Molecular Formula (Ac-SDKP): C20H33N5O9
  • Molecular Weight (Ac-SDKP): 487.5 g/mol
  • Sequence (Ac-SDKP): Ac-Ser-Asp-Lys-Pro
  • Synonyms: BPC-157 Arginate, TB-4 Fragment, Ac-SDKP, Goralatide, Seraspenide
Out of Stock
Selank 30 mg - Peptide Sciences USA Research Peptides
Peptide Sciences USA
  • Active Substance: Selank Anxiolytic Peptide
  • Concentration: 30 mg per vial
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: Selank
  • Molecular Formula: C33H57N11O9
  • Molecular Weight: 751.9 g/mol
  • Sequence: Thr-Lys-Pro-Arg-Pro-Gly-Pro (TKPRPGP)
  • Synonyms: Selank, TP-7, Tuftsin Analog
Out of Stock
Selank 5 mg - Peptide Sciences USA Research Peptides
Peptide Sciences USA

Product Details

  • Active Substance: Selank Anxiolytic Peptide
  • Concentration: 5 mg per vial
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: Selank
  • Molecular Formula: C33H57N11O9
  • Molecular Weight: 751.9 g/mol
  • Sequence: Thr-Lys-Pro-Arg-Pro-Gly-Pro (TKPRPGP)
  • Synonyms: Selank, TP-7, Tuftsin Analog
Out of Stock
Semax 30 mg - Peptide Sciences USA Research Peptides
Peptide Sciences USA
  • Active Substance: Semax Heptapeptide
  • Concentration: 30 mg per vial
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: Semax
  • Molecular Formula: C37H51N9O10S
  • Molecular Weight: 813.92 g/mol
  • Sequence: Met-Glu-His-Phe-Pro-Gly-Pro (MEHFPGP)
  • Synonyms: Semax, ACTH(4-10) Analog, Pro-Gly-Pro-ACTH
Out of Stock
Semax 2 mg - Peptide Sciences USA Research Peptides
Peptide Sciences USA
  • Active Substance: Semax Heptapeptide
  • Concentration: 30 mg per vial
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: Semax
  • Molecular Formula: C37H51N9O10S
  • Molecular Weight: 813.92 g/mol
  • Sequence: Met-Glu-His-Phe-Pro-Gly-Pro (MEHFPGP)
  • Synonyms: Semax, ACTH(4-10) Analog, Pro-Gly-Pro-ACTH
Out of Stock
Semax 5 mg - Peptide Sciences USA Research Peptides
Peptide Sciences USA
  • Active Substance: Semax Heptapeptide
  • Concentration: 5 mg per vial
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: Semax
  • Molecular Formula: C37H51N9O10S
  • Molecular Weight: 813.92 g/mol
  • Sequence: Met-Glu-His-Phe-Pro-Gly-Pro (MEHFPGP)
  • Synonyms: Semax, ACTH(4-10) Analog, Pro-Gly-Pro-ACTH
Out of Stock
Showing 50 of 66 products

Healing & Recovery Peptides

Healing and recovery peptides are compounds designed for use in scientific research involving tissue repair, inflammation control, injury recovery, and regeneration. These peptides often interact with growth factors, actin-regulating proteins, or collagen pathways to promote healing responses in cells and soft tissues. Researchers frequently use them in models involving tendon injury, muscle recovery, skin repair, and GI tract regeneration.

Top Healing Peptides for Laboratory Use

At BuyPeptides.net, we stock a wide range of recovery-focused peptides, including:

  • BPC-157 – A synthetic peptide studied for GI healing, soft tissue regeneration, and neuroprotection
  • TB-500 (Thymosin Beta-4) – Known for promoting cellular repair and actin regulation in injury models
  • GHK-Cu – A copper peptide that supports skin repair, hair regrowth, and anti-inflammatory processes
  • AHK-Cu – Studied for scalp health and collagen remodeling
  • Epitalon – A synthetic tetrapeptide explored in anti-aging and regenerative research
  • CJC-1295 + Ipamorelin – GH secretagogue blend often included in repair-based research protocols

All peptides are available in sterile packaging, with labeling for research use only. Select compounds may also be available in topical or oral forms depending on brand and formulation.

Benefits of Healing Peptides in Research

Healing peptides offer a targeted approach to cellular repair and inflammation control. Unlike NSAIDs or steroids, which broadly suppress symptoms, peptides typically work by enhancing the body's natural healing mechanisms. This makes them especially valuable in long-term or multi-phase regenerative studies.

Researchers use these peptides to explore:

  • Faster post-injury muscle or tendon recovery
  • Wound healing and collagen formation
  • Gut lining repair and systemic inflammation control
  • Hair regrowth, skin regeneration, and scar remodeling

Due to their targeted biological action, healing peptides have become increasingly popular in orthopedic, dermatological, and gastrointestinal research models.

Why Buy Healing Peptides from Research-Peptides.com?

At BuyPeptides.net, we work only with verified manufacturers who adhere to GMP and ISO-certified production practices. Whether you need BPC-157 for GI research or TB-500 for soft tissue repair models, we supply high-purity peptides with trusted documentation and fast fulfillment.

Our value-added benefits include:

  • Lab-tested compounds with available COAs
  • Multiple brand options including Peptide Sciences, Deus Medical, and more
  • Worldwide shipping with tracking and discreet packaging
  • Secure ordering and responsive customer support

All products are sold strictly for laboratory research use and are not approved for human or veterinary treatment. If you're conducting tissue regeneration or recovery-focused studies, our healing peptide category offers trusted options to power your research.

Menu
Account Cart