Fat Loss Peptides
Filters
Filters
Peptides By Research Purpose
Filter By Price
$
$
Brands
Substances
Manufacturers
Shipping Location
Default
Default
Price, low to high
Price, high to low
GHRP-6 10 mg
- Active Substance: Growth Hormone-Releasing Peptide 6 (GHRP-6)
- Concentration: 10 mg per vial
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: GHRP-6
- Molecular Formula: C46H56N12O6
- Molecular Weight: 873.01 g/mol
- Sequence: His-D-Trp-Ala-Trp-D-Phe-Lys-NH2
- Synonyms: Growth Hormone Secretagogue, GHRP-6
Out of Stock
Hexarelin 2 mg
- Active Substance: Hexarelin
- Concentration: 2 mg per vial
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: Hexarelin
- Molecular Formula: C47H58N12O6
- Molecular Weight: 887.04 g/mol
- Sequence: His-D-2-Me-Trp-Ala-Trp-D-Phe-Lys-NH2
- Synonyms: Growth Hormone Secretagogue, Examorelin
Out of Stock
hGH Fragment 176-191 6 mg
- Active Substance: Growth Hormone Peptide Fragment 176-191
- Concentration: 6 mg per vial
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: Fragment HGH
- Molecular Formula: C78H125N20O23S
- Molecular Weight: ~1817 g/mol
- Sequence: Tyr-Leu-Arg-Ile-Val-Gln-Cys-Arg-Ser-Val-Glu-Gly-Ser-Cys-Gly-Phe
- Synonyms: hGH Fragment, AOD9604
Out of Stock
IGF-1-LR3 1 mg
- Active Substance: Insulin-like Growth Factor 1, Long R3
- Concentration: 1 mg per vial
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: IGF-1 LR3
- Molecular Formula: C400H625N111O115S9
- Molecular Weight: 9117.5 g/mol
- Sequence: MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
- Synonyms: Long R3 IGF-1, LR3-IGF-1
Out of Stock
Ipamorelin 10 mg
- Active Substance: Ipamorelin
- Concentration: 10 mg per vial
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: Ipamorelin
- Molecular Formula: C38H49N9O5
- Molecular Weight: 711.85 g/mol
- Sequence: Aib-His-D-2-Nal-D-Phe-Lys-NH2
- Synonyms: Growth Hormone Secretagogue, GHRP
Out of Stock
Ipamorelin 5 mg
- Active Substance: Ipamorelin
- Concentration: 5 mg per vial
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: Ipamorelin
- Molecular Formula: C38H49N9O5
- Molecular Weight: 711.85 g/mol
- Sequence: Aib-His-D-2-Nal-D-Phe-Lys-NH2
- Synonyms: Growth Hormone Secretagogue, GHRP
Out of Stock
Ipamorelin 2 mg
- Active Substance: Ipamorelin
- Concentration: 2 mg per vial
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: Ipamorelin
- Molecular Formula: C38H49N9O5
- Molecular Weight: 711.85 g/mol
- Sequence: Aib-His-D-2-Nal-D-Phe-Lys-NH2
- Synonyms: Growth Hormone Secretagogue, GHRP
Out of Stock
Longevity - Performance & Obesity Research
- Active Substances: 5-amino-1MQ (50 mg/capsule), NMN (50 mg/capsule), JBSNF-000088 (5 mg/capsule)
- Concentration: 105 mg per capsule
- Pack Size: 60 capsules
- Manufacturer: Peptide Sciences USA
- Brand Name: Peptide Blend
- Molecular Formulas: 5-amino-1MQ (C10H11N2), NMN (C11H15N2O8P), JBSNF-000088 (C7H8N2O)
- Molecular Weights: 5-amino-1MQ (159.21 g/mol), NMN (334.22 g/mol), JBSNF-000088 (136.15 g/mol)
- Synonyms: 5-amino-1-methylquinolinium, Nicotinamide Mononucleotide, 6-Methoxynicotinamide
Out of Stock
MOTS-c 10 mg
- Active Substance: MOTS-c (Mitochondrial-Derived Peptide)
- Concentration: 10 mg per vial
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: MOTS-c
- Molecular Formula: C74H115N23O23S2
- Molecular Weight: 1718.97 g/mol
- Sequence: Met-Arg-Trp-Gln-Glu-Met-Gly-Tyr-Ile-Phe-Tyr-Pro-Arg-Lys-Leu-Arg
- Synonyms: Mitochondrial ORF of the 12S rRNA-c, MDP
Out of Stock
MOTS-c 5 mg
- Active Substance: MOTS-c (Mitochondrial-Derived Peptide)
- Concentration: 5 mg per vial
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: MOTS-c
- Molecular Formula: C74H115N23O23S2
- Molecular Weight: 1718.97 g/mol
- Sequence: Met-Arg-Trp-Gln-Glu-Met-Gly-Tyr-Ile-Phe-Tyr-Pro-Arg-Lys-Leu-Arg
- Synonyms: Mitochondrial ORF of the 12S rRNA-c, MDP
Out of Stock
SLU-PP-332
- Active Substance: SLU-PP-332 (Pan-ERR Agonist)
- Concentration: 1000 mcg per capsule
- Pack Size: 30 capsules (30,000 mcg total)
- Manufacturer: Peptide Sciences USA
- Brand Name: SLU-PP-332
- Molecular Formula: Not fully disclosed (medium-length peptide)
- Molecular Weight: 290.32 g/mol
- Sequence: Proprietary (10–30 amino acids)
- Synonyms: SLU-PP-332, ERR Agonist, Exercise Mimetic
Out of Stock
Tesamorelin / CJC1295 / Ipamorelin 12 mg
- Active Substances: Tesamorelin, CJC-1295 (Mod GRF 1-29, no DAC), Ipamorelin
- Concentration: 12 mg per vial (6 mg Tesamorelin, 3 mg CJC-1295, 3 mg Ipamorelin)
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: Peptide Blend
- Synonyms: Tesamorelin / CJC-1295 / Ipamorelin Blend, GHRH/GHRP Blend
Out of Stock
Tesamorelin 2 mg
- Active Substance: Tesamorelin
- Concentration: 2 mg per vial
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: Tesamorelin
- Molecular Formula: C221H366N72O67S
- Molecular Weight: 5135.89 g/mol
- Sequence: H-His-D-Trp-Ala-Trp-D-Phe-Lys-Thr-Phe-Thr-Ser-Tyr-Ser-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-Ser-Arg-NH2
- Synonyms: Egrifta, Growth Hormone-Releasing Factor (GHRF) Analog
Out of Stock
Tesamorelin 5 mg
- Active Substance: Tesamorelin (GHRH Analog)
- Concentration: 5 mg per vial
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: Tesamorelin
- Molecular Formula: C221H366N72O67S
- Molecular Weight: 5135.9 g/mol
- Sequence: 44 amino acids (proprietary GHRH analog)
- Synonyms: Tesamorelin Acetate, Egrifta, TH9507
Out of Stock
Tesofensine 500 mcg
- Active Substance: Tesofensine (Triple Monoamine Reuptake Inhibitor)
- Concentration: 500 mcg per capsule
- Pack Size: 30 capsules (15,000 mcg total)
- Manufacturer: Peptide Sciences USA
- Brand Name: Tesofensine
- Molecular Formula: C17H23Cl2NO
- Molecular Weight: 328.28 g/mol
- Sequence: Not a peptide (N-[3-(3,4-dichlorophenyl)-1-methylpropyl]-N-methylpropan-1-amine)
- Synonyms: NS2330, TE, Tesofensine Acetate
Out of Stock
Tirzepatide 5 mg
- Concentration: 5 mg per vial
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: Tirzepatide
- Molecular Formula: C225H348N56O67
- Molecular Weight: 4813.5 g/mol
- Synonyms: LY3298176, Dual Incretin Agonist Peptide
Out of Stock