IGF-1-LR3 1 mg
- Active Substance: Insulin-like Growth Factor 1, Long R3
- Concentration: 1 mg per vial
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: IGF-1 LR3
- Molecular Formula: C400H625N111O115S9
- Molecular Weight: 9117.5 g/mol
- Sequence: MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
- Synonyms: Long R3 IGF-1, LR3-IGF-1
IGF-1 LR3 1 mg – Torch of Anabolic Vitality
Ignite a Muscle Growth Revolution
Picture a research frontier where muscles surge, recovery accelerates, and fat melts away. IGF-1 LR3 1 mg from Peptide Sciences USA lights this fire. This potent 83-amino acid peptide, a modified IGF-1 analog, sparks systemic muscle hypertrophy and repair with a 20–30-hour half-life, fueling breakthroughs in anabolic and metabolic research. It's your torch for unlocking transformative discoveries, crafted for visionary researchers like you.
The Science That Ignites Anabolism
IGF-1 LR3 (sequence: MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA) is an 83-amino acid analog of IGF-1 with an arginine substitution at position 3 and a 13-amino acid N-terminal extension, reducing binding to IGF-binding proteins (IGFBPs) and extending its half-life to ~20–30 hours, making it ~3 times more potent than native IGF-1. It binds IGF-1 receptors, activating PI3K/Akt and MAPK pathways to drive hyperplasia (new muscle cell formation), hypertrophy, and nutrient uptake, per preclinical studies.
In animal models, IGF-1 LR3 increases muscle mass by 5–10% and enhances fat metabolism by channeling fat for energy production. It also promotes satellite cell proliferation for tissue repair, making it ideal for researching muscle wasting, injury recovery, and metabolic disorders. Unlike IGF-1 DES, its systemic action and longer half-life support broader tissue effects, including bone and connective tissue regeneration, per studies by Philippou et al. The 1 mg dosage offers precision for high-impact anabolic studies.
Why IGF-1 LR3 1 mg is Your Research Trailblazer
IGF-1 LR3 isn't just a peptide—it's a spark that redefines anabolic research. Here's why it shines:
- Muscle Growth Surge: Drives 5–10% muscle mass increase via hyperplasia and hypertrophy in preclinical models.
- Fat Loss Dynamo: Enhances lipolysis, reducing fat by channeling it for energy production.
- Recovery Booster: Accelerates satellite cell proliferation, cutting recovery time in injury models.
- Anti-Aging Edge: Supports bone density, connective tissue health, and vitality, driving longevity research.
- Elite Quality: Crafted by Peptide Sciences USA with 99% purity, ensuring your research dazzles with precision.
With IGF-1 LR3 1 mg, you're not just researching—you're igniting a revolution in muscle growth and metabolic vitality.
Product Specifications
Peptide Sciences USA's IGF-1 LR3 1 mg is your catalyst for groundbreaking anabolic research. Here's the breakdown:
- Composition: Contains 1 mg IGF-1 LR3 (C400H625N111O115S9, 9117.5 g/mol).
- Pack Size: Single vial of lyophilized powder, requiring reconstitution for subcutaneous or intramuscular injection.
- Manufacturing: Produced by Peptide Sciences USA with 99% purity, verified by HPLC and Mass Spectrometry.
- Usage Guidelines: Reconstitute with 1 mL bacteriostatic water (1 mg/mL) and administer 20–100 mcg subcutaneously or intramuscularly, once daily, ideally fasted or post-workout, in 4–6 week cycles, per research protocols. Use under professional supervision.
- Storage: Store lyophilized powder at -20°C for long-term stability or 4°C for short-term use (up to 3–4 weeks). After reconstitution, refrigerate at 2–8°C and use within 30 days.
- Safety: Preclinical studies report side effects like hypoglycemia, headaches, or muscle pain; prolonged use may risk acromegalic cardiomyopathy or cancer growth. Limited human data requires research oversight.
This peptide is for research purposes only, fueling discoveries in muscle growth and metabolic optimization.
Legal Disclaimer
IGF-1 LR3 1 mg is supplied for research purposes only and is not FDA-approved for human use. It is banned by the World Anti-Doping Agency (WADA) for performance-enhancing use. It is not intended to diagnose, treat, cure, or prevent any condition. Consult a licensed professional before use. Peptide Sciences USA assumes no liability for misuse. All information is educational and based on preclinical research.
Frequently Asked Questions
How to use IGF-1 LR3 for bodybuilding research?
In research, inject 20–100 mcg subcutaneously or intramuscularly daily, fasted or post-workout, in 4–6 week cycles to study muscle growth and recovery.
What is IGF-1 LR3?
IGF-1 LR3 is an 83-amino acid IGF-1 analog with a 20–30-hour half-life, ~3 times more potent, driving muscle hyperplasia and repair in preclinical studies.
How much IGF-1 LR3 should I take?
Research protocols suggest 20–100 mcg daily, injected subcutaneously or intramuscularly, with beginners starting at 20–40 mcg to assess effects.
Is IGF-1 LR3 a steroid?
No, IGF-1 LR3 is a peptide hormone, not a steroid. It promotes muscle growth via IGF-1 receptors, distinct from anabolic steroids' androgen receptor action.
What are the risks of taking IGF-1 LR3?
Preclinical studies note hypoglycemia, headaches, muscle pain, and potential cancer risks with prolonged use. Long-term human safety requires oversight.
Does IGF-1 LR3 really build muscle?
Yes, preclinical studies show IGF-1 LR3 increases muscle mass by 5–10% via hyperplasia and hypertrophy, enhancing protein synthesis and satellite cell activity.
Does IGF-1 LR3 affect testosterone?
IGF-1 LR3 does not directly affect testosterone levels but may enhance anabolic effects when combined with testosterone in research, per anecdotal reports.
[](https://jaycampbell.com/peptides/igf-1-lr3-peptide-benefits/)Related Products
- Active Substance: Epitalon
- Concentration: 50 mg per vial
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: Epitalon
- Molecular Formula: C14H22N4O9
- Molecular Weight: 390.35 g/mol
- Sequence: Ala-Glu-Asp-Gly
- Synonyms: Epithalon, AEDG, Epithalamin analog
- Active Substance: Proxofim (FOXO4-D-Retro-Inverso)
- Concentration: 10 mg per vial
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: Proxofim
- Molecular Formula: C228H388N86O64
- Molecular Weight: 5358.05 g/mol
- Sequence: H-D-Leu-D-Thr-D-Leu-D-Arg-D-Lys-D-Glu-D-Pro-D-Ala-D-Ser-D-Glu-D-Ile-D-Ala-D-Gln-D-Ser-D-Ile-D-Leu-D-Glu-D-Ala-D-Tyr-D-Ser-D-Gln-D-Asn-D-Gly-D-Trp-D-Ala-D-Asn-D-Arg-D-Arg-D-Ser-D-Gly-D-Gly-D-Lys-D-Arg-D-Pro-D-Pro-D-Pro-D-Arg-D-Arg-D-Arg-D-Gln-D-Arg-D-Arg-D-Lys-D-Lys-D-Arg-D-Gly-OH
- Synonyms: Forkhead box protein O4 D-Retro-Inverso, FOXO4a, AFX, AFX1, MLLT7
- Active Substance: HGH Fragment 176-191 (6 mg), Modified GRF (CJC-1295 No DAC, 3 mg), Ipamorelin (3 mg)
- Concentration: 12 mg per vial (6 mg HGH Fragment 176-191 + 3 mg Modified GRF + 3 mg Ipamorelin)
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: Peptide Blend
- Molecular Formula (HGH Fragment 176-191): C78H125N24O24S2
- Molecular Weight (HGH Fragment 176-191): 1817.12 g/mol
- Sequence (HGH Fragment 176-191): Tyr-Leu-Arg-Ile-Val-Gln-Cys-Arg-Ser-Val-Glu-Gly-Ser-Cys-Gly-Phe
- Molecular Formula (Modified GRF): C152H252N44O42
- Molecular Weight (Modified GRF): 3367.97 g/mol
- Sequence (Modified GRF): H-Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-Ser-Arg-NH2
- Molecular Formula (Ipamorelin): C38H49N9O5
- Molecular Weight (Ipamorelin): 711.85 g/mol
- Sequence (Ipamorelin): Aib-His-D-2-Nal-D-Phe-Lys-NH2
- Synonyms: HGH Fragment 176-191 (AOD9604), Modified GRF (CJC-1295 No DAC), Ipamorelin (GHRP, Ghrelin mimetic)
- Active Substance: HGH Fragment 176-191 (6 mg), CJC1295 No DAC (3 mg), Ipamorelin (3 mg)
- Concentration: 12 mg per vial (6 mg HGH Fragment 176-191 + 3 mg CJC1295 + 3 mg Ipamorelin)
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: Peptide Blend
- Molecular Formula (HGH Fragment 176-191): C78H125N24O24S2
- Molecular Weight (HGH Fragment 176-191): 1817.12 g/mol
- Sequence (HGH Fragment 176-191): Tyr-Leu-Arg-Ile-Val-Gln-Cys-Arg-Ser-Val-Glu-Gly-Ser-Cys-Gly-Phe
- Molecular Formula (CJC1295 No DAC): C152H252N44O42
- Molecular Weight (CJC1295 No DAC): 3367.97 g/mol
- Sequence (CJC1295 No DAC): H-Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-Ser-Arg-NH2
- Molecular Formula (Ipamorelin): C38H49N9O5
- Molecular Weight (Ipamorelin): 711.85 g/mol
- Sequence (Ipamorelin): Aib-His-D-2-Nal-D-Phe-Lys-NH2
- Synonyms: HGH Fragment 176-191 (AOD9604), CJC1295 No DAC (Mod GRF), Ipamorelin (GHRP, Ghrelin mimetic)
- Active Substance: Tripeptide-1 (Glycyl-L-Histidyl-L-Lysine)
- Concentration: 200 mg per vial
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: GHK Basic
- Molecular Formula: C14H24N6O4
- Molecular Weight: 340.38 g/mol
- Sequence: Gly-His-Lys
- Synonyms: GHK, Glycyl-L-Histidyl-L-Lysine, Tripeptide-1