Immune & Longevity Support Peptides
Filters
Filters
Peptides By Research Purpose
Filter By Price
$
$
Brands
Substances
Manufacturers
Shipping Location
Default
Default
Price, low to high
Price, high to low
SS-31 25 mg
- Active Substance: SS-31 Mitochondria-Targeting Peptide (Elamipretide)
- Concentration: 25 mg per vial
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: Elamipretide
- Molecular Formula: C32H49N9O5
- Molecular Weight: 639.8 g/mol
- Sequence: D-Arg-2,6-dimethylTyr-Lys-Phe-NH2
- Synonyms: Elamipretide, Bendavia, MTP-131
Out of Stock
TB-500 2 mg
- Active Substance: Thymosin Beta-4 (TB-500)
- Concentration: 2 mg per vial
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: TB-500
- Categories: Injectable Peptides, Healing & Recovery Peptides, Muscle Growth Peptides, Immune & Longevity Support Peptides
- Molecular Formula: C212H350N56O78S
- Molecular Weight: 4963.49 g/mol
- Sequence: SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
- Synonyms: Thymosin Beta-4, TB500
Out of Stock
TB-500 5 mg
- Active Substance: Thymosin Beta-4 (TB-500)
- Concentration: 5 mg per vial
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: TB-500
- Molecular Formula: C212H350N56O78S
- Molecular Weight: 4963.49 g/mol
- Synonyms: Thymosin Beta-4, TB500
Out of Stock
TB-500 Fragment (17-23) 10 mg
- Active Substance: TB-500 Fragment (17-23) (Fequesetide)
- Concentration: 10 mg per vial
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: TB-500
- Molecular Formula: C38H65N11O14
- Molecular Weight: 889.0 g/mol
- Sequence: Ac-LKKTETQ
- Synonyms: TB-500 Fragment, Fequesetide, Thymosin Beta-4 (17-23)
Out of Stock
Tesamorelin 2 mg
- Active Substance: Tesamorelin
- Concentration: 2 mg per vial
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: Tesamorelin
- Molecular Formula: C221H366N72O67S
- Molecular Weight: 5135.89 g/mol
- Sequence: H-His-D-Trp-Ala-Trp-D-Phe-Lys-Thr-Phe-Thr-Ser-Tyr-Ser-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-Ser-Arg-NH2
- Synonyms: Egrifta, Growth Hormone-Releasing Factor (GHRF) Analog
Out of Stock
Testagen 20 mg
- Active Substance: Testagen (Bioregulatory Tetrapeptide)
- Concentration: 20 mg per vial
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: Testagen
- Molecular Formula: C17H29N5O9
- Molecular Weight: 447.2 g/mol
- Sequence: Lys-Glu-Asp-Gly
- Synonyms: Testagen, KEDG, Anterior Pituitary Peptide (APP)
Out of Stock
Thymagen 20 mg
- Active Substance: Thymogen Alpha-1 (Glu-Trp, Lys-Glu)
- Concentration: 20 mg per vial
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: Thymogen
- Synonyms: Thymogen Alpha-1, Thymogen, Oglufanide
Out of Stock
Thymalin 20 mg
- Active Substance: Thymogen Alpha-1 (Glu-Trp, Lys-Glu)
- Concentration: 20 mg per vial
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: Thymogen
- Molecular Formula (Thymogen): C16H19N3O5
- Molecular Weight (Thymogen): 333.34 g/mol
- Molecular Formula (Immune Peptide A2): C11H20N2O5
- Molecular Weight (Immune Peptide A2): 260.29 g/mol
- Sequence (Thymogen): Glu-Trp
- Sequence (Immune Peptide A2): Lys-Glu
- Synonyms: Thymogen Alpha-1, Thymogen, Oglufanide
Out of Stock
Thymalin 50 mg
- Active Substance: Thymalin
- Concentration: 50 mg per vial
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: Thymalin
- Molecular Formula: Not fully defined – peptide complex derived from thymus extract
- Molecular Weight: Approx. 900–1200 Da (varies)
- Sequence: Peptide fractions with immune-regulatory activity (specific sequence not disclosed)
- Synonyms: Thymus Extract Peptide, Thymic Peptide Complex
Out of Stock
Thymosin Alpha-1 10 mg
- Active Substance: Thymosin Alpha-1
- Concentration: 10 mg per vial
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: Thymosin
- Molecular Formula: C129H215N33O55
- Molecular Weight: 3108.3 g/mol
- Synonyms: TA1, Zadaxin, Immune Modulator Peptide
Out of Stock
Thymosin Alpha-1 3 mg
- Active Substance: Thymosin Alpha-1
- Concentration: 3 mg per vial
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: Thymosin
- Molecular Formula: C129H215N33O55
- Molecular Weight: 3108.3 g/mol
- Synonyms: Thymalfasin, Zadaxin, Tα1
Out of Stock
TRH Thyrotropin 20 mg
- Concentration: 20 mg per vial
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: Protirelin
- Molecular Formula: C16H22N6O4
- Molecular Weight: 362.39 g/mol
- Sequence: pGlu-His-Pro-NH2
- Synonyms: Protirelin, Thyrotropin Releasing Hormone, TRH
Out of Stock
Triptorelin (GnRH) 2 mg
- Active Substance: Triptorelin
- Concentration: 2 mg per vial
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: Trelstar
- Molecular Formula: C64H82N18O13
- Molecular Weight: 1311.45 g/mol
- Sequence: pGlu-His-Trp-Ser-Tyr-D-Trp-Leu-Arg-Pro-Gly-NH2
- Synonyms: GnRH Agonist, Trelstar, Decapeptyl, Triptorelin Acetate
Out of Stock
Vesilute 20 mg
- Active Substance: Vesilute
- Concentration: 20 mg per vial
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Molecular Weight: Variable – peptide complex
- Sequence: Tissue-specific peptide fractions derived from bladder epithelium
- Synonyms: Vesugen, Cytogenetic Bladder Peptide, Vesilute Complex
Out of Stock
Vesugen 20 mg
- Active Substance: Vesugen
- Concentration: 20 mg per vial
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: Vesugen
- Molecular Formula: Not disclosed (custom cytogenetic peptide blend)
- Molecular Weight: Varies – proprietary peptide complex
- Sequence: Tissue-specific peptide chains derived from vascular DNA
- Synonyms: Vesilute (alternate branding), Vascular Cytogenetic Peptide
Out of Stock
Vilon 20 mg
- Active Substance: Vilon
- Concentration: 20 mg per vial
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: Vilon
- Molecular Formula: C10H14N2O5
- Molecular Weight: 242.23 g/mol
- Sequence: Glu-Asp-Ala
- Synonyms: Thymus Cytogenetic Peptide, Vilon Peptide, Immune Bioregulator
Out of Stock
VIP 6 mg
- Active Substance: Vasoactive Intestinal Peptide (VIP)
- Concentration: 6 mg per vial
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: VIP
- Molecular Formula: C147H237N43O42S
- Molecular Weight: 3326.9 g/mol
- Sequence: H-His-Ser-Asp-Ala-Val-Phe-Thr-Asp-Asn-Tyr-Thr-Arg-Leu-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Asn-Ser-Ile-Leu-Asn-NH2
- Synonyms: Vasoactive Intestinal Polypeptide, VIP-28, Neuroimmune Peptide
Out of Stock
OS-01 100 mg
- Active Substance: OS-01
- Concentration: 100 mg per capsule
- Pack Size: 30 capsules per bottle
- Manufacturer: Peptide Sciences USA
- Brand Name: OS-01
- Synonyms: OS1 Peptide, Epigenetic Anti-Aging Peptide, Longevity Peptide
Out of Stock
Sermorelin 5 mg
- Active Substance: Sermorelin
- Concentration: 5 mg per vial
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: Sermorelin
- Molecular Formula: C149H246N44O42S
- Molecular Weight: 3357.96 g/mol
- Synonyms: GHRH 1–29, Sermorelin Acetate, Growth Hormone-Releasing Factor analog
Out of Stock
Pancragen 20 mg
- Active Substance: Pancragen
- Concentration: 20 mg per vial
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: Pancragen
- Synonyms: Pancreatic Cytogenetic Peptide, Pancreatic Bioregulator, Peptide Biocomplex
Out of Stock
Out Of Stock
Out Of Stock
Out Of Stock
Out Of Stock
Out Of Stock
Out Of Stock
Out Of Stock
Out Of Stock
Out Of Stock
Out Of Stock
Out Of Stock
Out Of Stock
Out Of Stock
Out Of Stock
Out Of Stock
Out Of Stock
Out Of Stock
Out Of Stock
Out Of Stock
Out Of Stock