Home
About Us
FAQs
Articles
Contacts
News
Hello, Log In My Account
Shopping Cart $0.00
Subtotal $0.00
Shipping $0.00
Total $0.00
View Cart Checkout
TB-500 2 mg - Peptide Sciences USA Research Peptides

TB-500 2 mg

Peptide Sciences USA
  • Active Substance: Thymosin Beta-4 (TB-500)
  • Concentration: 2 mg per vial
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: TB-500
  • Categories: Injectable Peptides, Healing & Recovery Peptides, Muscle Growth Peptides, Immune & Longevity Support Peptides
  • Molecular Formula: C212H350N56O78S
  • Molecular Weight: 4963.49 g/mol
  • Sequence: SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
  • Synonyms: Thymosin Beta-4, TB500
Manufacturer Peptide Sciences USA
Brand TB 500
Substance Thymosin Beta 4
Concentration 2 mg
Pack Size vial
Out of Stock

TB-500 (Thymosin Beta-4) is a synthetic version of a naturally occurring peptide involved in tissue regeneration, cell migration, and angiogenesis. Supplied in a 2 mg injectable format by Peptide Sciences USA, TB-500 is widely studied for its potential to accelerate healing in soft tissue, tendons, ligaments, and muscle. Its ability to promote recovery and reduce inflammation makes it a cornerstone of regenerative and sports injury research.

Mechanism of Action

Thymosin Beta-4, the active substance in TB-500, plays a critical role in cell migration, wound repair, and cytoskeleton organization. It binds to actin monomers, regulating their polymerization and enabling cells to move and proliferate more efficiently. This is essential in repairing injured tissues and forming new blood vessels (angiogenesis).

TB-500 is thought to redistribute actin across injured regions, promoting tissue remodeling and accelerating regeneration. It also supports the formation of new capillaries, which enhance oxygen and nutrient delivery to damaged tissues. Additionally, TB-500 exhibits anti-inflammatory properties by reducing cytokine activity, contributing to pain relief and swelling reduction in injured areas.

Due to its broad cellular activity, TB-500 is explored across various research applications, including post-surgical recovery, soft tissue injuries, cardiac damage, and inflammation-driven disorders.

Key Features & Benefits

  • Accelerated Tissue Healing: Promotes regeneration of muscles, tendons, ligaments, and skin tissue in research models.
  • Supports Cell Migration: Facilitates actin polymerization and movement of cells to the site of injury.
  • Anti-Inflammatory Effects: Reduces cytokine activity and inflammation markers in injury and post-surgical settings.
  • Angiogenesis Promotion: Encourages formation of new blood vessels for enhanced tissue oxygenation.
  • Versatile Research Uses: Studied in wound healing, muscle recovery, and chronic tissue degeneration protocols.
  • High Purity Injectable: Provided as a 2 mg research-grade vial by Peptide Sciences USA for controlled scientific applications.

Legal Disclaimer

Disclaimer: TB-500 is intended strictly for research and laboratory purposes. It is not a medical treatment or supplement and is not approved by the FDA for human or animal use. Use only by qualified professionals in compliant environments.

Frequently Asked Questions

1. What is TB-500 peptide?
TB-500 is a synthetic version of Thymosin Beta-4, studied for its role in healing muscle, tendon, and tissue damage through enhanced cell migration and anti-inflammatory activity.
2. What is TB-500 used for?
It is researched in contexts involving tissue repair, post-surgical recovery, injury healing, and inflammation reduction in soft tissue models.
3. Is TB-500 a steroid?
No. TB-500 is not a steroid. It is a peptide that mimics a naturally occurring protein involved in cellular healing and regeneration processes.
4. What does TB-500 peptide do?
TB-500 promotes tissue repair by improving cell movement, boosting blood vessel formation, and reducing inflammation at injury sites in scientific research settings.

Related Products

TB 500 - Dragon Pharma Research Peptides
Dragon Pharma
  • Active Substance: Thymosin Beta 4 (TB 500)
  • Concentration: 5 mg per vial
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Dragon Pharma
  • Brand Name: TB 500
  • Molecular Formula: C212H350N56O78S
  • Molecular Weight: 4963.49 g/mol
  • Synonyms: TB500, Thymosin Beta-4 Fragment, Fequesetide
$55.00
Epithalon 50 mg - Peptide Sciences USA Research Peptides
Peptide Sciences USA
  • Active Substance: Epitalon
  • Concentration: 50 mg per vial
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: Epitalon
  • Molecular Formula: C14H22N4O9
  • Molecular Weight: 390.35 g/mol
  • Sequence: Ala-Glu-Asp-Gly
  • Synonyms: Epithalon, AEDG, Epithalamin analog
Out of Stock
FOX04-DRI 10 mg - Peptide Sciences USA Research Peptides
Peptide Sciences USA
  • Active Substance: Proxofim (FOXO4-D-Retro-Inverso)
  • Concentration: 10 mg per vial
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: Proxofim
  • Molecular Formula: C228H388N86O64
  • Molecular Weight: 5358.05 g/mol
  • Sequence: H-D-Leu-D-Thr-D-Leu-D-Arg-D-Lys-D-Glu-D-Pro-D-Ala-D-Ser-D-Glu-D-Ile-D-Ala-D-Gln-D-Ser-D-Ile-D-Leu-D-Glu-D-Ala-D-Tyr-D-Ser-D-Gln-D-Asn-D-Gly-D-Trp-D-Ala-D-Asn-D-Arg-D-Arg-D-Ser-D-Gly-D-Gly-D-Lys-D-Arg-D-Pro-D-Pro-D-Pro-D-Arg-D-Arg-D-Arg-D-Gln-D-Arg-D-Arg-D-Lys-D-Lys-D-Arg-D-Gly-OH
  • Synonyms: Forkhead box protein O4 D-Retro-Inverso, FOXO4a, AFX, AFX1, MLLT7
Out of Stock
Fragment / Modified GRF / Ipamorelin 12 mg - Peptide Sciences USA Research Peptides
Peptide Sciences USA
  • Active Substance: HGH Fragment 176-191 (6 mg), Modified GRF (CJC-1295 No DAC, 3 mg), Ipamorelin (3 mg)
  • Concentration: 12 mg per vial (6 mg HGH Fragment 176-191 + 3 mg Modified GRF + 3 mg Ipamorelin)
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: Peptide Blend
  • Molecular Formula (HGH Fragment 176-191): C78H125N24O24S2
  • Molecular Weight (HGH Fragment 176-191): 1817.12 g/mol
  • Sequence (HGH Fragment 176-191): Tyr-Leu-Arg-Ile-Val-Gln-Cys-Arg-Ser-Val-Glu-Gly-Ser-Cys-Gly-Phe
  • Molecular Formula (Modified GRF): C152H252N44O42
  • Molecular Weight (Modified GRF): 3367.97 g/mol
  • Sequence (Modified GRF): H-Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-Ser-Arg-NH2
  • Molecular Formula (Ipamorelin): C38H49N9O5
  • Molecular Weight (Ipamorelin): 711.85 g/mol
  • Sequence (Ipamorelin): Aib-His-D-2-Nal-D-Phe-Lys-NH2
  • Synonyms: HGH Fragment 176-191 (AOD9604), Modified GRF (CJC-1295 No DAC), Ipamorelin (GHRP, Ghrelin mimetic)
Out of Stock
Fragment / CJC1295 / Ipamorelin 12 mg - Peptide Sciences USA Research Peptides
Peptide Sciences USA
  • Active Substance: HGH Fragment 176-191 (6 mg), CJC1295 No DAC (3 mg), Ipamorelin (3 mg)
  • Concentration: 12 mg per vial (6 mg HGH Fragment 176-191 + 3 mg CJC1295 + 3 mg Ipamorelin)
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: Peptide Blend
  • Molecular Formula (HGH Fragment 176-191): C78H125N24O24S2
  • Molecular Weight (HGH Fragment 176-191): 1817.12 g/mol
  • Sequence (HGH Fragment 176-191): Tyr-Leu-Arg-Ile-Val-Gln-Cys-Arg-Ser-Val-Glu-Gly-Ser-Cys-Gly-Phe
  • Molecular Formula (CJC1295 No DAC): C152H252N44O42
  • Molecular Weight (CJC1295 No DAC): 3367.97 g/mol
  • Sequence (CJC1295 No DAC): H-Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-Ser-Arg-NH2
  • Molecular Formula (Ipamorelin): C38H49N9O5
  • Molecular Weight (Ipamorelin): 711.85 g/mol
  • Sequence (Ipamorelin): Aib-His-D-2-Nal-D-Phe-Lys-NH2
  • Synonyms: HGH Fragment 176-191 (AOD9604), CJC1295 No DAC (Mod GRF), Ipamorelin (GHRP, Ghrelin mimetic)
Out of Stock
Menu
Account Cart