Cagrilintide 10 mg

Subtotal	$0.00
Shipping	$0.00
Total	$0.00

Cagrilintide 10 mg - Peptide Sciences USA Research Peptides

Active Substance: Cagrilintide
Concentration: 10 mg per vial
Pack Size: Single vial (lyophilized powder)
Manufacturer: Peptide Sciences USA
Brand Name: Cagrilintide
Molecular Formula: C₁₉₄H₃₁₂N₅₄O₅₉S₂.xC₂H₄O₂
Molecular Weight: 4409.01 g/mol
Sequence: XKCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP
Synonyms: AM833, AT42613

Manufacturer	Peptide Sciences USA
Brand	Cagrilintide
Substance	Cagrilintide
Concentration	10 mg
Pack Size	vial

Out of Stock

Research Peptides Description

Cagrilintide 10 mg – The Master Key to Weight Loss Research

Product Summary

Picture a research landscape where appetite control, weight loss, and metabolic health align seamlessly. Cagrilintide 10 mg vial from Peptide Sciences USA, a long-acting amylin analog, unlocks this potential. Designed to mimic the pancreatic hormone amylin, Cagrilintide suppresses appetite, slows gastric emptying, and stabilizes blood sugar, offering a cutting-edge tool for researchers redefining weight management and metabolic health studies.

How Cagrilintide Works

Cagrilintide, a synthetic amylin analog (sequence: XKCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP), targets amylin and calcitonin receptors in brain regions like the area postrema and hypothalamus, promoting satiety and reducing food intake. Its lipidated structure, incorporating 14E/17R and 25P/28P/29P mutations, enhances stability and extends half-life compared to natural amylin, which degrades rapidly. By slowing gastric emptying, Cagrilintide prolongs feelings of fullness, reducing caloric intake, while also modulating postprandial glucose spikes to support glycemic control.

In phase 2 clinical trials, Cagrilintide (0.3–4.5 mg weekly) achieved 6–10.8% body weight reduction over 26 weeks in non-diabetic obese individuals, outperforming placebo (3%) and liraglutide 3.0 mg (9%). When combined with semaglutide 2.4 mg, it led to a 17.1% weight loss in 20 weeks, highlighting synergistic potential with GLP-1 agonists. These results position Cagrilintide as a powerful candidate for obesity and type 2 diabetes research.

Why Choose Cagrilintide 10 mg?

Cagrilintide is a trailblazer in weight loss research, offering a multi-faceted approach to metabolic health. Here's why it stands out:

Significant Weight Loss: Achieves 6–10.8% body weight reduction in 26 weeks, with up to 17.1% when combined with semaglutide, surpassing traditional therapies.,
Appetite Suppression: Enhances satiety via amylin receptor activation, reducing caloric intake and supporting sustained weight loss.,
Glycemic Control: Stabilizes blood sugar levels, reducing HbA1c by up to 2.2% in type 2 diabetes studies, ideal for metabolic research.
Synergistic Potential: Combines effectively with GLP-1 agonists like semaglutide for enhanced weight loss and metabolic benefits.
Premier Quality: Peptide Sciences USA ensures 99% purity through advanced synthesis, guaranteeing reliable research outcomes.

Cagrilintide 10 mg empowers researchers to redefine weight loss and metabolic health studies, backed by the prestige of cutting-edge peptide science.

Product Specifications

Peptide Sciences USA's Cagrilintide 10 mg vial is engineered for precision in weight management research, delivering unmatched quality. Here's the breakdown:

Composition: Contains 10 mg of Cagrilintide (C₁₉₄H₃₁₂N₅₄O₅₉S₂.xC₂H₄O₂, molecular weight 4409.01 g/mol).
Pack Size: Single vial of lyophilized powder, requiring reconstitution for subcutaneous injection.
Manufacturing: Produced by Peptide Sciences USA with 99% purity, verified by High-Performance Liquid Chromatography and Mass Spectrometry.
Usage Guidelines: Reconstitute with bacteriostatic water and administer subcutaneously, typically at 0.3–4.5 mg weekly in research protocols, with gradual dose escalation. Use under professional supervision.
Storage: Store lyophilized powder at -20°C. After reconstitution, refrigerate at 2–8°C and use within 30 days.
Safety: Phase 2 trials report mild to moderate gastrointestinal side effects (e.g., nausea, constipation); limited human data requires research oversight.

This peptide is for research purposes only, providing a robust platform for studying weight loss and metabolic health.

Legal Disclaimer

Cagrilintide 10 mg is supplied for research purposes only and is not FDA-approved for human use, though it is under phase 3 clinical trials. It is not intended to diagnose, treat, cure, or prevent any condition. Consult a licensed professional before use. Peptide Sciences USA assumes no liability for misuse. All information is educational and based on preclinical and clinical research.

Frequently Asked Questions

What is Cagrilintide peptide used for?

Cagrilintide is used in research to explore weight loss, appetite suppression, and metabolic health. It mimics amylin, a pancreatic hormone, to reduce food intake, slow gastric emptying, and stabilize blood sugar, with potential applications in obesity and type 2 diabetes studies.

Is Cagrilintide good?

Cagrilintide shows significant promise in research, achieving 6–10.8% weight loss in 26 weeks and up to 17.1% when combined with semaglutide in phase 2 trials. Its tolerability and synergy with GLP-1 agonists make it a strong candidate for weight management and metabolic studies.

How much weight can you lose on Cagrilintide?

In phase 2 trials, Cagrilintide (0.3–4.5 mg weekly) led to 6–10.8% body weight loss (6.4–11.5 kg) over 26 weeks in non-diabetic obese individuals, with 17.1% loss when combined with semaglutide 2.4 mg over 20 weeks. Results vary by dose and protocol.

What are Cagrilintide side effects?

Clinical trials report mild to moderate gastrointestinal side effects, including nausea (20–47%), constipation, and diarrhea, with rare cases of acute cholelithiasis at higher doses. Side effects often diminish with gradual dose escalation. Research requires professional oversight.

How is Cagrilintide 10 mg administered in research?

Cagrilintide is supplied as a 10 mg lyophilized powder. Reconstitute with bacteriostatic water and administer subcutaneously, typically at 0.3–4.5 mg weekly in research protocols, with gradual dose escalation to minimize side effects.