IGF-1 DES 1 mg
- Active Substance: Insulin-Like Growth Factor 1, DES
- Concentration: 1 mg per vial
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: IGF-1 DES
- Molecular Formula: C319H501N91O96S7
- Molecular Weight: ~7377 g/mol
- Sequence: TLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
- Synonyms: DES(1-3)IGF-1, Truncated IGF-1
IGF-1 DES 1 mg – Spark of Anabolic Precision
Ignite a Muscle Growth Revolution
Picture a research frontier where muscles surge, tissues heal, and metabolism thrives. IGF-1 DES 1 mg from Peptide Sciences USA lights this fire. This truncated IGF-1 variant, 10 times more potent than standard IGF-1, sparks localized muscle hypertrophy and repair, fueling breakthroughs in anabolic and metabolic research. It's your spark for unlocking transformative discoveries, crafted for visionary researchers like you.
The Science That Ignites Anabolism
IGF-1 DES (sequence: TLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA) is a 67-amino acid peptide lacking the N-terminal tripeptide of IGF-1, reducing binding to IGF-binding proteins (IGFBPs) and boosting potency by 10-fold, per preclinical studies. It binds IGF-1 receptors on muscle cells, activating PI3K/Akt pathways to drive hyperplasia (new cell formation) and hypertrophy, with a short half-life (~20–30 minutes) ideal for site-specific effects.
In animal models, IGF-1 DES enhances muscle growth by 2–3 times over IGF-1, promotes fat metabolism, and accelerates tissue repair, particularly in tendons and ligaments. Its ability to bind receptors affected by lactic acid makes it potent during exercise-induced stress, supporting targeted muscle development. Ideal for researching muscle wasting, injury recovery, and metabolic disorders, IGF-1 DES's 1 mg dosage offers precision for high-impact studies.
Why IGF-1 DES 1 mg is Your Research Trailblazer
IGF-1 DES isn't just a peptide—it's a spark that redefines anabolic research. Here's why it shines:
- Muscle Growth Surge: Drives 2–3 times greater hypertrophy and hyperplasia than IGF-1 in preclinical models.
- Fat Loss Dynamo: Enhances lipolysis, channeling fat for energy production in metabolic studies.
- Tissue Repair Booster: Accelerates tendon and ligament healing, ideal for injury recovery research.
- Anti-Aging Edge: Supports metabolic health and vitality, driving longevity research.
- Elite Quality: Crafted by Peptide Sciences USA with 99% purity, ensuring your research dazzles with precision.
With IGF-1 DES 1 mg, you're not just researching—you're igniting a revolution in muscle growth and metabolic vitality.
Product Specifications
Peptide Sciences USA's IGF-1 DES 1 mg is your catalyst for groundbreaking anabolic research. Here's the breakdown:
- Composition: Contains 1 mg IGF-1 DES (C319H501N91O96S7, ~7377 g/mol).
- Pack Size: Single vial of lyophilized powder, requiring reconstitution for intramuscular or subcutaneous injection.
- Manufacturing: Produced by Peptide Sciences USA with 99% purity, verified by HPLC and Mass Spectrometry.
- Usage Guidelines: Reconstitute with 1 mL bacteriostatic water (1 mg/mL) and administer 25–100 mcg intramuscularly or subcutaneously, 15 minutes pre-workout, in research protocols. Use under professional supervision.
- Storage: Store lyophilized powder at -20°C for long-term stability or 4°C for short-term use (up to 3–4 weeks). After reconstitution, refrigerate at 2–8°C and use within 30 days.
- Safety: Preclinical studies report side effects like hypoglycemia, headaches, or nausea; prolonged use may risk acromegalic cardiomyopathy. Limited human data requires research oversight.
This peptide is for research purposes only, fueling discoveries in muscle growth and tissue repair.
Legal Disclaimer
IGF-1 DES 1 mg is supplied for research purposes only and is not FDA-approved for human use. It is banned by the World Anti-Doping Agency (WADA) for performance-enhancing use. It is not intended to diagnose, treat, cure, or prevent any condition. Consult a licensed professional before use. Peptide Sciences USA assumes no liability for misuse. All information is educational and based on preclinical research.
Frequently Asked Questions
What are IGF-1 DES 1 mg side effects?
Preclinical studies note hypoglycemia, headaches, or nausea. Prolonged use may risk acromegalic cardiomyopathy; human safety requires oversight.
What is IGF-1 DES used for?
IGF-1 DES fuels research into localized muscle growth, fat loss, and tissue repair, targeting muscle wasting and metabolic disorders.
How many mg of IGF-1 DES should I take?
In research, 25–100 mcg daily, injected intramuscularly or subcutaneously pre-workout, is typical for studying anabolic effects.
How is IGF-1 DES 1 mg administered in research?
Mix the 1 mg vial with 1 mL bacteriostatic water and inject 25–100 mcg intramuscularly or subcutaneously, pre-workout, for targeted muscle studies.
How does IGF-1 DES differ from IGF-1 LR3?
IGF-1 DES has a shorter half-life (~20–30 min) for site-specific muscle growth, while IGF-1 LR3 (~20–30 hr) offers systemic effects.
Related Products
- Active Substance: Epitalon
- Concentration: 50 mg per vial
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: Epitalon
- Molecular Formula: C14H22N4O9
- Molecular Weight: 390.35 g/mol
- Sequence: Ala-Glu-Asp-Gly
- Synonyms: Epithalon, AEDG, Epithalamin analog
- Active Substance: Proxofim (FOXO4-D-Retro-Inverso)
- Concentration: 10 mg per vial
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: Proxofim
- Molecular Formula: C228H388N86O64
- Molecular Weight: 5358.05 g/mol
- Sequence: H-D-Leu-D-Thr-D-Leu-D-Arg-D-Lys-D-Glu-D-Pro-D-Ala-D-Ser-D-Glu-D-Ile-D-Ala-D-Gln-D-Ser-D-Ile-D-Leu-D-Glu-D-Ala-D-Tyr-D-Ser-D-Gln-D-Asn-D-Gly-D-Trp-D-Ala-D-Asn-D-Arg-D-Arg-D-Ser-D-Gly-D-Gly-D-Lys-D-Arg-D-Pro-D-Pro-D-Pro-D-Arg-D-Arg-D-Arg-D-Gln-D-Arg-D-Arg-D-Lys-D-Lys-D-Arg-D-Gly-OH
- Synonyms: Forkhead box protein O4 D-Retro-Inverso, FOXO4a, AFX, AFX1, MLLT7
- Active Substance: HGH Fragment 176-191 (6 mg), Modified GRF (CJC-1295 No DAC, 3 mg), Ipamorelin (3 mg)
- Concentration: 12 mg per vial (6 mg HGH Fragment 176-191 + 3 mg Modified GRF + 3 mg Ipamorelin)
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: Peptide Blend
- Molecular Formula (HGH Fragment 176-191): C78H125N24O24S2
- Molecular Weight (HGH Fragment 176-191): 1817.12 g/mol
- Sequence (HGH Fragment 176-191): Tyr-Leu-Arg-Ile-Val-Gln-Cys-Arg-Ser-Val-Glu-Gly-Ser-Cys-Gly-Phe
- Molecular Formula (Modified GRF): C152H252N44O42
- Molecular Weight (Modified GRF): 3367.97 g/mol
- Sequence (Modified GRF): H-Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-Ser-Arg-NH2
- Molecular Formula (Ipamorelin): C38H49N9O5
- Molecular Weight (Ipamorelin): 711.85 g/mol
- Sequence (Ipamorelin): Aib-His-D-2-Nal-D-Phe-Lys-NH2
- Synonyms: HGH Fragment 176-191 (AOD9604), Modified GRF (CJC-1295 No DAC), Ipamorelin (GHRP, Ghrelin mimetic)
- Active Substance: HGH Fragment 176-191 (6 mg), CJC1295 No DAC (3 mg), Ipamorelin (3 mg)
- Concentration: 12 mg per vial (6 mg HGH Fragment 176-191 + 3 mg CJC1295 + 3 mg Ipamorelin)
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: Peptide Blend
- Molecular Formula (HGH Fragment 176-191): C78H125N24O24S2
- Molecular Weight (HGH Fragment 176-191): 1817.12 g/mol
- Sequence (HGH Fragment 176-191): Tyr-Leu-Arg-Ile-Val-Gln-Cys-Arg-Ser-Val-Glu-Gly-Ser-Cys-Gly-Phe
- Molecular Formula (CJC1295 No DAC): C152H252N44O42
- Molecular Weight (CJC1295 No DAC): 3367.97 g/mol
- Sequence (CJC1295 No DAC): H-Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-Ser-Arg-NH2
- Molecular Formula (Ipamorelin): C38H49N9O5
- Molecular Weight (Ipamorelin): 711.85 g/mol
- Sequence (Ipamorelin): Aib-His-D-2-Nal-D-Phe-Lys-NH2
- Synonyms: HGH Fragment 176-191 (AOD9604), CJC1295 No DAC (Mod GRF), Ipamorelin (GHRP, Ghrelin mimetic)
- Active Substance: Tripeptide-1 (Glycyl-L-Histidyl-L-Lysine)
- Concentration: 200 mg per vial
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: GHK Basic
- Molecular Formula: C14H24N6O4
- Molecular Weight: 340.38 g/mol
- Sequence: Gly-His-Lys
- Synonyms: GHK, Glycyl-L-Histidyl-L-Lysine, Tripeptide-1