IGF-1 DES 1 mg

Peptide Sciences USA
  • Active Substance: Insulin-Like Growth Factor 1, DES
  • Concentration: 1 mg per vial
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: IGF-1 DES
  • Molecular Formula: C319H501N91O96S7
  • Molecular Weight: ~7377 g/mol
  • Sequence: TLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
  • Synonyms: DES(1-3)IGF-1, Truncated IGF-1
Manufacturer Peptide Sciences USA
Brand IGF-1 DES
Substance Insulin-Like Growth Factor 1
Concentration 1 mg
Pack Size vial
Out of Stock

IGF-1 DES 1 mg – Spark of Anabolic Precision

Ignite a Muscle Growth Revolution

Picture a research frontier where muscles surge, tissues heal, and metabolism thrives. IGF-1 DES 1 mg from Peptide Sciences USA lights this fire. This truncated IGF-1 variant, 10 times more potent than standard IGF-1, sparks localized muscle hypertrophy and repair, fueling breakthroughs in anabolic and metabolic research. It's your spark for unlocking transformative discoveries, crafted for visionary researchers like you.

The Science That Ignites Anabolism

IGF-1 DES (sequence: TLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA) is a 67-amino acid peptide lacking the N-terminal tripeptide of IGF-1, reducing binding to IGF-binding proteins (IGFBPs) and boosting potency by 10-fold, per preclinical studies. It binds IGF-1 receptors on muscle cells, activating PI3K/Akt pathways to drive hyperplasia (new cell formation) and hypertrophy, with a short half-life (~20–30 minutes) ideal for site-specific effects.

In animal models, IGF-1 DES enhances muscle growth by 2–3 times over IGF-1, promotes fat metabolism, and accelerates tissue repair, particularly in tendons and ligaments. Its ability to bind receptors affected by lactic acid makes it potent during exercise-induced stress, supporting targeted muscle development. Ideal for researching muscle wasting, injury recovery, and metabolic disorders, IGF-1 DES's 1 mg dosage offers precision for high-impact studies.

Why IGF-1 DES 1 mg is Your Research Trailblazer

IGF-1 DES isn't just a peptide—it's a spark that redefines anabolic research. Here's why it shines:

  • Muscle Growth Surge: Drives 2–3 times greater hypertrophy and hyperplasia than IGF-1 in preclinical models.
  • Fat Loss Dynamo: Enhances lipolysis, channeling fat for energy production in metabolic studies.
  • Tissue Repair Booster: Accelerates tendon and ligament healing, ideal for injury recovery research.
  • Anti-Aging Edge: Supports metabolic health and vitality, driving longevity research.
  • Elite Quality: Crafted by Peptide Sciences USA with 99% purity, ensuring your research dazzles with precision.

With IGF-1 DES 1 mg, you're not just researching—you're igniting a revolution in muscle growth and metabolic vitality.

Product Specifications

Peptide Sciences USA's IGF-1 DES 1 mg is your catalyst for groundbreaking anabolic research. Here's the breakdown:

  • Composition: Contains 1 mg IGF-1 DES (C319H501N91O96S7, ~7377 g/mol).
  • Pack Size: Single vial of lyophilized powder, requiring reconstitution for intramuscular or subcutaneous injection.
  • Manufacturing: Produced by Peptide Sciences USA with 99% purity, verified by HPLC and Mass Spectrometry.
  • Usage Guidelines: Reconstitute with 1 mL bacteriostatic water (1 mg/mL) and administer 25–100 mcg intramuscularly or subcutaneously, 15 minutes pre-workout, in research protocols. Use under professional supervision.
  • Storage: Store lyophilized powder at -20°C for long-term stability or 4°C for short-term use (up to 3–4 weeks). After reconstitution, refrigerate at 2–8°C and use within 30 days.
  • Safety: Preclinical studies report side effects like hypoglycemia, headaches, or nausea; prolonged use may risk acromegalic cardiomyopathy. Limited human data requires research oversight.

This peptide is for research purposes only, fueling discoveries in muscle growth and tissue repair.

Frequently Asked Questions

What are IGF-1 DES 1 mg side effects?

Preclinical studies note hypoglycemia, headaches, or nausea. Prolonged use may risk acromegalic cardiomyopathy; human safety requires oversight.

What is IGF-1 DES used for?

IGF-1 DES fuels research into localized muscle growth, fat loss, and tissue repair, targeting muscle wasting and metabolic disorders.

How many mg of IGF-1 DES should I take?

In research, 25–100 mcg daily, injected intramuscularly or subcutaneously pre-workout, is typical for studying anabolic effects.

How is IGF-1 DES 1 mg administered in research?

Mix the 1 mg vial with 1 mL bacteriostatic water and inject 25–100 mcg intramuscularly or subcutaneously, pre-workout, for targeted muscle studies.

How does IGF-1 DES differ from IGF-1 LR3?

IGF-1 DES has a shorter half-life (~20–30 min) for site-specific muscle growth, while IGF-1 LR3 (~20–30 hr) offers systemic effects.