LL-37 5 mg

Peptide Sciences USA
  • Active Substance: LL-37 (Cathelicidin)
  • Concentration: 5 mg per vial
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: LL-37
  • Molecular Formula: C205H340N60O53
  • Molecular Weight: 4493.3 g/mol
  • Sequence: [LL-37, 37 aa]
  • Synonyms: Cathelicidin, hCAP-18 (C-terminal)
Manufacturer Peptide Sciences USA
Brand LL-37
Substance LL-37
Concentration 5 mg
Pack Size vial
Out of Stock

LL-37 5 mg – Wave of Immune Strength

Boost Your Immune Research

Picture a lab where infections are stopped, wounds heal fast, and inflammation fades. LL-37 5 mg from Peptide Sciences USA makes this real. This powerful cathelicidin peptide fights bacteria, fungi, and viruses while speeding up tissue repair. It's your wave of strength for groundbreaking studies on immune defense and skin health, designed for innovative researchers like you.

The Science Behind Immune Power

LL-37 (sequence: [LL-37, 37 aa]) is a 37-amino acid cationic peptide from hCAP-18, disrupting microbial membranes at nanomolar concentrations, per Scott et al. It targets *Staphylococcus aureus*, *Candida albicans*, and enveloped viruses by binding lipopolysaccharides and phospholipids. LL-37 also modulates immunity, reducing TNF-α and IL-6 by up to 30% while boosting IL-18 and neutrophil recruitment, per Dalmasso et al.

In clinical trials, topical LL-37 (0.5–1.6 mg/mL) cut venous leg ulcer size by 50–68% in 4 weeks. It activates EGFR and MAPK/ERK pathways to enhance epithelial cell migration, speeding wound healing, and may suppress gastric cancer via BMP signaling, per Shaykhiev et al. The 5 mg dosage is ideal for studying infections, psoriasis, and autoimmune conditions, with applications in IBD and oncology.

Why LL-37 5 mg Powers Your Studies

LL-37 isn't just a peptide—it's a game-changer for immune and healing research. Here's what makes it stand out:

  • Fights Infections: Kills *S. aureus*, *C. albicans*, and viruses at low concentrations, per studies.
  • Fast Wound Healing: Shrinks ulcers by 50–68% in clinical trials, boosting tissue repair.
  • Calms Inflammation: Cuts TNF-α by 30%, balancing immune responses in psoriasis models.
  • Skin Health Support: Enhances skin repair, ideal for anti-aging and dermatology research.
  • Top Quality: Crafted by Peptide Sciences USA with 99% purity for precise, reliable results.

With LL-37 5 mg, you're not just studying—you're leading a charge in immune strength and healing innovation.

Product Specifications

Peptide Sciences USA's LL-37 5 mg is your key to cutting-edge immune health studies. Here's the breakdown:

  • Composition: Contains 5 mg LL-37 (C205H340N60O53, 4493.3 g/mol).
  • Pack Size: Single vial of lyophilized powder, requiring reconstitution for subcutaneous or topical use.
  • Manufacturing: Produced by Peptide Sciences USA with 99% purity, verified by HPLC and Mass Spectrometry.
  • Usage Guidelines: Reconstitute with 2 mL bacteriostatic water (2.5 mg/mL). Inject 100–125 mcg subcutaneously daily or apply 0.5–1.6 mg/mL topically twice weekly for 4–12 weeks in research protocols. Use under professional supervision.
  • Storage: Store lyophilized powder at -20°C for long-term stability or 4°C for short-term use (up to 3–4 weeks). After reconstitution, refrigerate at 2–8°C and use within 28 days.
  • Safety: Clinical trials note mild side effects like redness or irritation; high topical doses (≥3.2 mg/mL) may cause skin cell toxicity. Limited human data requires oversight.

This peptide is for research purposes only, driving discoveries in antimicrobial defense and tissue repair.

Frequently Asked Questions

What does peptide LL-37 do?

LL-37 fights infections, speeds wound healing (50–68% ulcer reduction), and calms inflammation, ideal for immune and skin health studies.

What is LL-37 in psoriasis?

In psoriasis, LL-37 may increase inflammation via M1 macrophages but also reduces TNF-α, aiding skin repair in research models.

What is LL-37 peptide for Candida?

LL-37 kills *Candida albicans* by disrupting fungal membranes, offering strong antifungal effects for infection studies, per research.

How does LL-37 affect anti-infective immunity?

LL-37 boosts immunity by killing pathogens, increasing IL-18, and recruiting neutrophils, enhancing infection defense, per studies.

How is LL-37 5 mg administered in research?

Mix the 5 mg vial with 2 mL bacteriostatic water. Inject 100–125 mcg subcutaneously daily or apply 0.5–1.6 mg/mL topically for studies.