Buy PNC-27 5 mg for Cancer Research Peptide

Subtotal	$0.00
Shipping	$0.00
Total	$0.00

PNC-27 5 mg - Peptide Sciences USA Research Peptides

Active Substance: PNC-27 Anti-Cancer Peptide
Concentration: 5 mg per vial
Pack Size: Single vial (lyophilized powder)
Manufacturer: Peptide Sciences USA
Brand Name: PNC-27
Molecular Formula: C₁₈₈H₂₉₃N₅₃O₄₄S
Molecular Weight: 4031.7 g/mol
Sequence: PPLSQETFSDLWKLL-KKWKMRRNQFWVKVQRG
Synonyms: PNC-27 Peptide, p53 12-26 Penetratin

Manufacturer	Peptide Sciences USA
Brand	PNC-27
Substance	PNC-27 Anti-Cancer Peptide
Concentration	5 mg
Pack Size	vial

Out of Stock

Research Peptides Description

PNC-27 5 mg – Surge of Anti-Cancer Precision

Fuel Your Cancer Research

Picture a lab where cancer cells are selectively destroyed, leaving healthy cells untouched. PNC-27 5 mg from Peptide Sciences USA makes this real. This anti-cancer peptide binds HDM-2 to induce tumor cell necrosis, offering a targeted approach for groundbreaking immunotherapy research. It's your surge for leading transformative studies, crafted for trailblazing researchers like you.

The Science Behind Anti-Cancer Precision

PNC-27 is a 32-amino-acid peptide (p53 residues 12–26: PPLSQETFSDLWKLL, linked to penetratin: KKWKMRRNQFWVKVQRG) that binds HDM-2 in cancer cell membranes, forming transmembrane pores that cause rapid necrosis (LD50: 100–150 µg/mL in ovarian cancer cells). Unlike apoptosis, PNC-27's membranolysis is p53-independent, targeting solid (e.g., pancreatic, breast, melanoma) and non-solid (e.g., leukemia) tumors. It co-localizes with HDM-2 in cancer cell membranes, forming 1:1 complexes, with no effect on normal cells due to low HDM-2 expression.

In vivo, PNC-27 eradicated pancreatic tumors in mice (10 mg over 2 weeks), per [web:5,16]. It also disrupts mitochondrial membranes, enhancing cytotoxicity. The 5 mg injectable dosage is ideal for studying cancers like leukemia, breast, and ovarian, with potential for early cancer detection via nanoparticles. Strict handling is required due to bacterial contamination risks (e.g., Variovorax paradoxus, Ralstonia insidiosa).

Why PNC-27 5 mg Fuels Your Studies

PNC-27 isn't just a peptide—it's a surge that transforms cancer research. Here's what makes it shine:

Tumor Cell Necrosis: Induces rapid membranolysis (LD50: 100–150 µg/mL).
Selective Targeting: Binds HDM-2 in cancer cells, sparing normal cells.
Broad Efficacy: Effective against pancreatic, breast, leukemia, and melanoma.
Immunotherapy Potential: Enhances immune response via tumor cell lysis.
Top Quality: Crafted by Peptide Sciences USA with 99% purity for reliable results.

With PNC-27 5 mg, you're not just studying—you're leading a breakthrough in anti-cancer precision.

Product Specifications

Peptide Sciences USA's PNC-27 5 mg is your key to cutting-edge cancer research. Here's the breakdown:

Composition: Contains 5 mg PNC-27 (C₁₈₈H₂₉₃N₅₃O₄₄S, 4031.7 g/mol).
Pack Size: Single vial of lyophilized powder, requiring reconstitution for intravenous or subcutaneous injection.
Manufacturing: Produced by Peptide Sciences USA with 99% purity, verified by HPLC and Mass Spectrometry.
Usage Guidelines: Reconstitute with 1–2 mL bacteriostatic water (2.5–5 mg/mL). Inject 100–300 µg intravenously or subcutaneously daily for 2–4 weeks in research protocols. Use under strict professional supervision due to contamination risks.
Storage: Store lyophilized powder at -20°C for long-term stability or 4°C for short-term use (up to 3–4 weeks). After reconstitution, refrigerate at 2–8°C and use within 4–6 weeks.
Safety: Preclinical studies report minimal side effects; bacterial contamination (e.g., Variovorax paradoxus, Ralstonia insidiosa) poses infection risks, requiring sterile handling; limited human data requires oversight.

This peptide is for research purposes only, driving discoveries in cancer immunotherapy and tumor necrosis.

Legal Disclaimer

PNC-27 5 mg is supplied for research purposes only and is not FDA-approved for therapeutic use, per regulations as of 2025. The FDA warns of bacterial contamination risks (e.g., Variovorax paradoxus, Ralstonia insidiosa) in PNC-27 products, which may cause serious infections, especially in vulnerable populations, per [web:0]. It is banned by the World Anti-Doping Agency (WADA) for performance-enhancing use. It is not intended to diagnose, treat, cure, or prevent any condition. Consult a licensed professional before use. Peptide Sciences USA assumes no liability for misuse. All information is educational and based on preclinical research.

Frequently Asked Questions

What is PNC-27 used for?

PNC-27 is used in research to study tumor cell necrosis in cancers like pancreatic, breast, and leukemia via HDM-2 binding.

What is the half life of PNC-27?

PNC-27's half-life is short (hours), requiring daily dosing in research to maintain efficacy.

Can peptides help fight cancer?

Peptides like PNC-27 show promise in preclinical studies by inducing tumor cell necrosis, but human efficacy is unproven.

Is PNC-27 and PNC-28 the Best way to cure Cancer?

PNC-27 and PNC-28 are promising in preclinical research, but they are not proven cures; clinical trials are needed.

What is the difference between PNC-27 and PNC-28?

PNC-27 includes p53 residues 12–26, while PNC-28 uses 17–26; both bind HDM-2, but PNC-27 has a longer sequence.

PNC-27 5 mg