Buy Peptides by Research Purpose | Muscle, Fat Loss, Brain Page 2

Subtotal	$0.00
Shipping	$0.00
Total	$0.00

Showing 50 of 170 products

Sort:

Image

SKU

Product

Rating

Price

Peptide Sciences USA

CJC-1295 / Hexarelin 10 mg

Product Title: CJC-1295 / Hexarelin 10 mg
Active Substance: Duo-Blend CJC-1295 No DAC and Hexarelin (5 mg each)
Concentration: 10 mg per vial (5 mg CJC-1295 No DAC + 5 mg Hexarelin)
Pack Size: Single vial (lyophilized powder)
Manufacturer: Peptide Sciences USA
Brand Name: Peptide Blend
Molecular Formula (CJC-1295 No DAC): C₁₅₂H₂₅₂N₄₄O₄₂
Molecular Weight (CJC-1295 No DAC): 3367.97 g/mol
Sequence (CJC-1295 No DAC): H-Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-Ser-Arg-NH2
Molecular Formula (Hexarelin): C₄₇H₅₈N₁₂O₆
Molecular Weight (Hexarelin): 887.04 g/mol
Sequence (Hexarelin): His-D-2-methyl-Trp-Ala-Trp-D-Phe-Lys-NH2
Synonyms: CJC-1295 No DAC (Modified GRF 1-29, Sermorelin analog), Hexarelin (Examorelin, Growth Hormone-Releasing Hexapeptide)

Peptide Sciences USA

CJC-1295 no DAC 2 mg

Active Substance: CJC-1295 No DAC
Concentration: 2 mg per vial
Pack Size: Single vial (lyophilized powder)
Manufacturer: Peptide Sciences USA
Brand Name: Mod GRF (1-29)
Molecular Formula: C₁₅₂H₂₅₂N₄₄O₄₂
Molecular Weight: 3367.97 g/mol
Sequence: H-Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-Ser-Arg-NH2
Synonyms: Modified GRF (1-29), Sermorelin analog

Peptide Sciences USA

CJC1295 / Ipamorelin / GHRP-2

Active Substance: CJC-1295 DAC / Ipamorelin / GHRP-2 (3 mg each)
Concentration: 9 mg per vial (3 mg CJC-1295 DAC + 3 mg Ipamorelin + 3 mg GHRP-2)
Pack Size: Single vial (lyophilized powder)
Manufacturer: Peptide Sciences USA
Brand Name: Peptide Blend
Molecular Formula (CJC-1295 DAC): C₁₅₂H₂₅₂N₄₄O₄₂ (with DAC modification)
Molecular Weight (CJC-1295 DAC): ~3367.97 g/mol
Sequence (CJC-1295 DAC): H-Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-Ser-Arg-Lys(Maleimidopropionyl)-NH2
Molecular Formula (Ipamorelin): C₃₈H₄₉N₉O₅
Molecular Weight (Ipamorelin): 711.85 g/mol
Sequence (Ipamorelin): Aib-His-D-2-Nal-D-Phe-Lys-NH2
Molecular Formula (GHRP-2): C₄₅H₅₅N₉O₆
Molecular Weight (GHRP-2): 818.0 g/mol
Sequence (GHRP-2): D-Ala-D-2-Nal-Ala-Trp-D-Phe-Lys-NH2
Synonyms: CJC-1295 DAC (DAC:GRF), Ipamorelin (GHRP, Ghrelin mimetic), GHRP-2 (Pralmorelin)

Peptide Sciences USA

Cortagen 20 mg

Active Substance: Cortagen
Concentration: 20 mg per vial
Pack Size: Single vial (lyophilized powder)
Manufacturer: Peptide Sciences USA
Brand Name: Cortagen
Molecular Formula: C₁₇H₂₇N₅O₈
Molecular Weight: 430.17 g/mol
Sequence: Ala-Glu-Asp-Pro
Synonyms: AEDP, SCHEMBL5491754

Peptide Sciences USA

Decapeptide-12

Product Title: Decapeptide-12
Active Substance: Decapeptide-12
Concentration: 200 mg
Pack Size: Topical
Manufacturer: Peptide Sciences USA
Brand Name: Decapeptide
Molecular Formula: C₆₅H₉₀N₁₈O₁₇
Molecular Weight: 1311.46 g/mol
Sequence: Tyr-Arg-Ser-Arg-Lys-Tyr-Ser-Ser-Trp-Tyr
Synonyms: YRSRKYSSWY, Lumixyl

Peptide Sciences USA

DSIP 5 mg

Active Substance: Delta-sleep-inducing peptide
Concentration: 5 mg per vial
Pack Size: Single vial (lyophilized powder)
Manufacturer: Peptide Sciences USA
Brand Name: DSIP
Molecular Formula: C₃₅H₄₈N₁₀O₁₅
Molecular Weight: 848.81 g/mol
Sequence: Trp-Ala-Gly-Gly-Asp-Ala-Ser-Gly-Glu
Synonyms: Delta-sleep-inducing peptide, WAGGDASGE

Peptide Sciences USA

Duo-Blend Mod GRF / GHRP-2 10 mg

Active Substance: Modified GRF (CJC-1295 No DAC) and GHRP-2 (5 mg each)
Concentration: 10 mg per vial (5 mg Mod GRF + 5 mg GHRP-2)
Pack Size: Single vial (lyophilized powder)
Manufacturer: Peptide Sciences USA
Brand Name: Peptide Blend
Molecular Formula (Mod GRF): C₁₅₂H₂₅₂N₄₄O₄₂
Molecular Weight (Mod GRF): 3367.97 g/mol
Sequence (Mod GRF): H-Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-Ser-Arg-NH2
Molecular Formula (GHRP-2): C₄₅H₅₅N₉O₆
Molecular Weight (GHRP-2): 818.0 g/mol
Sequence (GHRP-2): D-Ala-D-2-Nal-Ala-Trp-D-Phe-Lys-NH2
Synonyms: Mod GRF (CJC-1295 No DAC, Sermorelin analog), GHRP-2 (Pralmorelin)

Peptide Sciences USA

Duo-Blend Mod GRF / GHRP-6 10 mg

Active Substance: Modified GRF (CJC-1295 No DAC) and GHRP-6 (5 mg each)
Concentration: 10 mg per vial (5 mg Mod GRF + 5 mg GHRP-6)
Pack Size: Single vial (lyophilized powder)
Manufacturer: Peptide Sciences USA
Brand Name: Peptide Blend
Molecular Formula (Mod GRF): C₁₅₂H₂₅₂N₄₄O₄₂
Molecular Weight (Mod GRF): 3367.97 g/mol
Sequence (Mod GRF): H-Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-Ser-Arg-NH2
Molecular Formula (GHRP-6): C₄₆H₅₆N₁₂O₆
Molecular Weight (GHRP-6): 873.01 g/mol
Sequence (GHRP-6): His-D-Trp-Ala-Trp-D-Phe-Lys-NH2
Synonyms: Mod GRF (CJC-1295 No DAC, Sermorelin analog), GHRP-6 (Growth Hormone-Releasing Hexapeptide)

Peptide Sciences USA

Duo-Blend Mod GRF / Ipamorelin 10 mg

Active Substance: Modified GRF (CJC-1295 No DAC) and Ipamorelin (5 mg each)
Concentration: 10 mg per vial (5 mg Mod GRF + 5 mg Ipamorelin)
Pack Size: Single vial (lyophilized powder)
Manufacturer: Peptide Sciences USA
Brand Name: Peptide Blend
Molecular Formula (Mod GRF): C₁₅₂H₂₅₂N₄₄O₄₂
Molecular Weight (Mod GRF): 3367.97 g/mol
Sequence (Mod GRF): H-Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-Ser-Arg-NH2
Molecular Formula (Ipamorelin): C₃₈H₄₉N₉O₅
Molecular Weight (Ipamorelin): 711.85 g/mol
Sequence (Ipamorelin): Aib-His-D-2-Nal-D-Phe-Lys-NH2
Synonyms: Mod GRF (CJC-1295 No DAC, Sermorelin analog), Ipamorelin (GHRP, Ghrelin mimetic)

Peptide Sciences USA

Duo-Blend Sermorelin / GHRP-2 10 mg

Active Substance: Sermorelin (Mod GRF, GHRH 1-29) and GHRP-2 (5 mg each)
Concentration: 10 mg per vial (5 mg Sermorelin + 5 mg GHRP-2)
Pack Size: Single vial (lyophilized powder)
Manufacturer: Peptide Sciences USA
Brand Name: Peptide Blend
Molecular Formula (Sermorelin): C₁₄₉H₂₄₆N₄₄O₄₂S
Molecular Weight (Sermorelin): 3357.93 g/mol
Sequence (Sermorelin): Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-NH2
Molecular Formula (GHRP-2): C₄₅H₅₅N₉O₆
Molecular Weight (GHRP-2): 818.0 g/mol
Sequence (GHRP-2): D-Ala-D-2-Nal-Ala-Trp-D-Phe-Lys-NH2
Synonyms: Sermorelin (GHRH 1-29, Mod GRF), GHRP-2 (Pralmorelin)

Peptide Sciences USA

Duo-Blend Sermorelin / GHRP-6 10 mg

Active Substance: Sermorelin (GHRH 1-29) and GHRP-6 (5 mg each)
Concentration: 10 mg per vial (5 mg Sermorelin + 5 mg GHRP-6)
Pack Size: Single vial (lyophilized powder)
Manufacturer: Peptide Sciences USA
Brand Name: Peptide Blend
Molecular Formula (Sermorelin): C₁₄₉H₂₄₆N₄₄O₄₂S
Molecular Weight (Sermorelin): 3357.93 g/mol
Sequence (Sermorelin): Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-NH2
Molecular Formula (GHRP-6): C₄₆H₅₆N₁₂O₆
Molecular Weight (GHRP-6): 873.01 g/mol
Sequence (GHRP-6): His-D-Trp-Ala-Trp-D-Phe-Lys-NH2
Synonyms: Sermorelin (GHRH 1-29, Mod GRF), GHRP-6 (Growth Hormone-Releasing Hexapeptide)

Peptide Sciences USA

Duo-Blend Sermorelin / Ipamorelin 10 mg

Active Substance: Sermorelin (GHRH 1-29) and Ipamorelin (5 mg each)
Concentration: 10 mg per vial (5 mg Sermorelin + 5 mg Ipamorelin)
Pack Size: Single vial (lyophilized powder)
Manufacturer: Peptide Sciences USA
Brand Name: Peptide Blend
Molecular Formula (Sermorelin): C₁₄₉H₂₄₆N₄₄O₄₂S
Molecular Weight (Sermorelin): 3357.93 g/mol
Sequence (Sermorelin): Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-NH2
Molecular Formula (Ipamorelin): C₃₈H₄₉N₉O₅
Molecular Weight (Ipamorelin): 711.85 g/mol
Sequence (Ipamorelin): Aib-His-D-2-Nal-D-Phe-Lys-NH2
Synonyms: Sermorelin (GHRH 1-29, Mod GRF), Ipamorelin (GHRP, Ghrelin mimetic)

Peptide Sciences USA

Duo-Blend Tesamorelin / Ipamorelin 8 mg

Active Substance: Tesamorelin (6 mg) and Ipamorelin (2 mg)
Concentration: 8 mg per vial (6 mg Tesamorelin + 2 mg Ipamorelin)
Pack Size: Single vial (lyophilized powder)
Manufacturer: Peptide Sciences USA
Brand Name: Peptide Blend
Molecular Formula (Tesamorelin): C₂₂₁H₃₆₆N₇₂O₆₇S
Molecular Weight (Tesamorelin): 5135.86 g/mol
Sequence (Tesamorelin): Unk-Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-Gln-Gln-Gly-Glu-Ser-Asn-Gln-Glu-Arg-Gly-Ala-Arg-Ala-Arg-Leu-NH2
Molecular Formula (Ipamorelin): C₃₈H₄₉N₉O₅
Molecular Weight (Ipamorelin): 711.85 g/mol
Sequence (Ipamorelin): Aib-His-D-2-Nal-D-Phe-Lys-NH2
Synonyms: Tesamorelin (Egrifta, TH9507), Ipamorelin (GHRP, Ghrelin mimetic)

Peptide Sciences USA

Epitalon 3 mg Capsule

Active Substance: Epitalon
Concentration: 3 mg per capsule
Pack Size: 60 capsules
Manufacturer: Peptide Sciences USA
Brand Name: Epitalon
Molecular Formula: C₁₄H₂₂N₄O₉
Molecular Weight: 390.35 g/mol
Sequence: Ala-Glu-Asp-Gly
Synonyms: Epithalon, AEDG, Epithalamin analog

Peptide Sciences USA

Epithalon 50 mg

Active Substance: Epitalon
Concentration: 50 mg per vial
Pack Size: Single vial (lyophilized powder)
Manufacturer: Peptide Sciences USA
Brand Name: Epitalon
Molecular Formula: C₁₄H₂₂N₄O₉
Molecular Weight: 390.35 g/mol
Sequence: Ala-Glu-Asp-Gly
Synonyms: Epithalon, AEDG, Epithalamin analog

Peptide Sciences USA

FOX04-DRI 10 mg

Active Substance: Proxofim (FOXO4-D-Retro-Inverso)
Concentration: 10 mg per vial
Pack Size: Single vial (lyophilized powder)
Manufacturer: Peptide Sciences USA
Brand Name: Proxofim
Molecular Formula: C₂₂₈H₃₈₈N₈₆O₆₄
Molecular Weight: 5358.05 g/mol
Sequence: H-D-Leu-D-Thr-D-Leu-D-Arg-D-Lys-D-Glu-D-Pro-D-Ala-D-Ser-D-Glu-D-Ile-D-Ala-D-Gln-D-Ser-D-Ile-D-Leu-D-Glu-D-Ala-D-Tyr-D-Ser-D-Gln-D-Asn-D-Gly-D-Trp-D-Ala-D-Asn-D-Arg-D-Arg-D-Ser-D-Gly-D-Gly-D-Lys-D-Arg-D-Pro-D-Pro-D-Pro-D-Arg-D-Arg-D-Arg-D-Gln-D-Arg-D-Arg-D-Lys-D-Lys-D-Arg-D-Gly-OH
Synonyms: Forkhead box protein O4 D-Retro-Inverso, FOXO4a, AFX, AFX1, MLLT7

Peptide Sciences USA

Fragment / Modified GRF / Ipamorelin 12 mg

Active Substance: HGH Fragment 176-191 (6 mg), Modified GRF (CJC-1295 No DAC, 3 mg), Ipamorelin (3 mg)
Concentration: 12 mg per vial (6 mg HGH Fragment 176-191 + 3 mg Modified GRF + 3 mg Ipamorelin)
Pack Size: Single vial (lyophilized powder)
Manufacturer: Peptide Sciences USA
Brand Name: Peptide Blend
Molecular Formula (HGH Fragment 176-191): C₇₈H₁₂₅N₂₄O₂₄S₂
Molecular Weight (HGH Fragment 176-191): 1817.12 g/mol
Sequence (HGH Fragment 176-191): Tyr-Leu-Arg-Ile-Val-Gln-Cys-Arg-Ser-Val-Glu-Gly-Ser-Cys-Gly-Phe
Molecular Formula (Modified GRF): C₁₅₂H₂₅₂N₄₄O₄₂
Molecular Weight (Modified GRF): 3367.97 g/mol
Sequence (Modified GRF): H-Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-Ser-Arg-NH2
Molecular Formula (Ipamorelin): C₃₈H₄₉N₉O₅
Molecular Weight (Ipamorelin): 711.85 g/mol
Sequence (Ipamorelin): Aib-His-D-2-Nal-D-Phe-Lys-NH2
Synonyms: HGH Fragment 176-191 (AOD9604), Modified GRF (CJC-1295 No DAC), Ipamorelin (GHRP, Ghrelin mimetic)

Peptide Sciences USA

Fragment / CJC1295 / Ipamorelin 12 mg

Active Substance: HGH Fragment 176-191 (6 mg), CJC1295 No DAC (3 mg), Ipamorelin (3 mg)
Concentration: 12 mg per vial (6 mg HGH Fragment 176-191 + 3 mg CJC1295 + 3 mg Ipamorelin)
Pack Size: Single vial (lyophilized powder)
Manufacturer: Peptide Sciences USA
Brand Name: Peptide Blend
Molecular Formula (HGH Fragment 176-191): C₇₈H₁₂₅N₂₄O₂₄S₂
Molecular Weight (HGH Fragment 176-191): 1817.12 g/mol
Sequence (HGH Fragment 176-191): Tyr-Leu-Arg-Ile-Val-Gln-Cys-Arg-Ser-Val-Glu-Gly-Ser-Cys-Gly-Phe
Molecular Formula (CJC1295 No DAC): C₁₅₂H₂₅₂N₄₄O₄₂
Molecular Weight (CJC1295 No DAC): 3367.97 g/mol
Sequence (CJC1295 No DAC): H-Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-Ser-Arg-NH2
Molecular Formula (Ipamorelin): C₃₈H₄₉N₉O₅
Molecular Weight (Ipamorelin): 711.85 g/mol
Sequence (Ipamorelin): Aib-His-D-2-Nal-D-Phe-Lys-NH2
Synonyms: HGH Fragment 176-191 (AOD9604), CJC1295 No DAC (Mod GRF), Ipamorelin (GHRP, Ghrelin mimetic)

Peptide Sciences USA

GHK Basic 200 mg

Active Substance: Tripeptide-1 (Glycyl-L-Histidyl-L-Lysine)
Concentration: 200 mg per vial
Pack Size: Single vial (lyophilized powder)
Manufacturer: Peptide Sciences USA
Brand Name: GHK Basic
Molecular Formula: C₁₄H₂₄N₆O₄
Molecular Weight: 340.38 g/mol
Sequence: Gly-His-Lys
Synonyms: GHK, Glycyl-L-Histidyl-L-Lysine, Tripeptide-1

Peptide Sciences USA

GHK Basic 50 mg

Active Substance: Tripeptide-1 (Glycyl-L-Histidyl-L-Lysine)
Concentration: 50 mg per vial
Pack Size: Single vial (lyophilized powder)
Manufacturer: Peptide Sciences USA
Brand Name: GHK Basic
Molecular Formula: C₁₄H₂₄N₆O₄
Molecular Weight: 340.38 g/mol
Sequence: Gly-His-Lys
Synonyms: GHK, Glycyl-L-Histidyl-L-Lysine, Tripeptide-1

Peptide Sciences USA

GHK-Cu 1000 mg

Active Substance: Glycyl-L-Histidyl-L-Lysine Copper Complex (GHK-Cu)
Concentration: 1000 mg per container
Pack Size: Topical formulation
Manufacturer: Peptide Sciences USA
Brand Name: GHK-Cu
Molecular Formula: C₁₄H₂₂N₆O₄Cu
Molecular Weight: ~403 g/mol
Sequence: Gly-His-Lys-Cu
Synonyms: Copper Tripeptide-1, GHK Copper Peptide

Peptide Sciences USA

GHK-Cu 2 mg

Active Substance: Glycyl-L-Histidyl-L-Lysine Copper Complex (GHK-Cu)
Concentration: 2 mg per capsule
Pack Size: 60 capsules
Manufacturer: Peptide Sciences USA
Brand Name: GHK-Cu
Categories: Oral Peptides, Immune & Longevity Support Peptides, Anti-Aging & Skin Health Peptides
Molecular Formula: C₁₄H₂₂N₆O₄Cu
Molecular Weight: ~403 g/mol
Sequence: Gly-His-Lys-Cu
Synonyms: Copper Tripeptide-1, GHK Copper Peptide

Peptide Sciences USA

GHK-Cu 200 mg

Active Substance: Glycyl-L-Histidyl-L-Lysine Copper Complex (GHK-Cu)
Concentration: 200 mg per container
Pack Size: Single container (lyophilized powder for topical formulation)
Manufacturer: Peptide Sciences USA
Brand Name: GHK-Cu
Molecular Formula: C₁₄H₂₂N₆O₄Cu
Molecular Weight: ~403 g/mol
Sequence: Gly-His-Lys-Cu
Synonyms: Copper Tripeptide-1, GHK Copper Peptide

Peptide Sciences USA

GHK-Cu 50 mg

Active Substance: Glycyl-L-Histidyl-L-Lysine Copper Complex (GHK-Cu)
Concentration: 50 mg per vial
Pack Size: Single vial (lyophilized powder)
Manufacturer: Peptide Sciences USA
Brand Name: GHK-Cu
Molecular Formula: C₁₄H₂₂N₆O₄Cu
Molecular Weight: ~403 g/mol
Sequence: Gly-His-Lys-Cu
Synonyms: Copper Tripeptide-1, GHK Copper Peptide

Peptide Sciences USA

GHK-Cu 500 mg

Active Substance: Glycyl-L-Histidyl-L-Lysine Copper Complex (GHK-Cu)
Concentration: 500 mg per container
Pack Size: Single container (lyophilized powder for topical formulation)
Manufacturer: Peptide Sciences USA
Brand Name: GHK-Cu
Molecular Formula: C₁₄H₂₂N₆O₄Cu
Molecular Weight: ~403 g/mol
Sequence: Gly-His-Lys-Cu
Synonyms: Copper Tripeptide-1, GHK Copper Peptide

Peptide Sciences USA

GHRH 5 mg

Active Substance: Growth Hormone–Releasing Hormone (Sermorelin analog)
Concentration: 5 mg per vial
Pack Size: Single vial (lyophilized powder)
Manufacturer: Peptide Sciences USA
Brand Name: Somatoliberin
Molecular Formula: C₁₄₉H₂₄₆N₄₄O₄₂S
Molecular Weight: 3357.93 g/mol
Sequence: Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-NH2
Synonyms: Somatoliberin, Sermorelin, GHRH 1-29

Peptide Sciences USA

GHRP-2 10 mg

Active Substance: Growth Hormone-Releasing Peptide 2 (GHRP-2)
Concentration: 10 mg per vial
Pack Size: Single vial (lyophilized powder)
Manufacturer: Peptide Sciences USA
Brand Name: GHRP-2
Molecular Formula: C₄₅H₅₅N₉O₆
Molecular Weight: 818.0 g/mol
Sequence: D-Ala-D-2-Nal-Ala-Trp-D-Phe-Lys-NH2
Synonyms: Pralmorelin, Growth Hormone Secretagogue

Peptide Sciences USA

GHRP-2 5 mg

Active Substance: Growth Hormone-Releasing Peptide 2 (GHRP-2)
Concentration: 5 mg per vial
Pack Size: Single vial (lyophilized powder)
Manufacturer: Peptide Sciences USA
Brand Name: GHRP-2
Molecular Formula: C₄₅H₅₅N₉O₆
Molecular Weight: 818.0 g/mol
Sequence: D-Ala-D-2-Nal-Ala-Trp-D-Phe-Lys-NH2
Synonyms: Pralmorelin, Growth Hormone Secretagogue

Peptide Sciences USA

GHRP-6 10 mg

Active Substance: Growth Hormone-Releasing Peptide 6 (GHRP-6)
Concentration: 10 mg per vial
Pack Size: Single vial (lyophilized powder)
Manufacturer: Peptide Sciences USA
Brand Name: GHRP-6
Molecular Formula: C₄₆H₅₆N₁₂O₆
Molecular Weight: 873.01 g/mol
Sequence: His-D-Trp-Ala-Trp-D-Phe-Lys-NH2
Synonyms: Growth Hormone Secretagogue, GHRP-6

Peptide Sciences USA

GHRP-6 5 mg

Active Substance: Growth Hormone-Releasing Peptide 6 (GHRP-6)
Concentration: 5 mg per vial
Pack Size: Single vial (lyophilized powder)
Manufacturer: Peptide Sciences USA
Brand Name: GHRP-6
Molecular Formula: C₄₆H₅₆N₁₂O₆
Molecular Weight: 873.01 g/mol
Sequence: His-D-Trp-Ala-Trp-D-Phe-Lys-NH2
Synonyms: Growth Hormone Secretagogue, GHRP-6

Peptide Sciences USA

Gonadorelin 10 mg

Active Substance: Gonadotropin-Releasing Hormone (Gonadorelin)
Concentration: 10 mg per vial
Pack Size: Single vial (lyophilized powder)
Manufacturer: Peptide Sciences USA
Brand Name: Gonadorelin
Molecular Formula: C₅₅H₇₅N₁₇O₁₃
Molecular Weight: 1182.29 g/mol
Sequence: pGlu-His-Trp-Ser-Tyr-Gly-Leu-Arg-Pro-Gly-NH2
Synonyms: GnRH, LHRH, Gonadotropin-Releasing Hormone

Peptide Sciences USA

Gut Inflammation

Active Substances: Stable BPC-157 (Arginate Salt, 500 mcg), KPV (500 mcg), PEA (400 mg), Tributyrin (400 mg)
Concentration: 801 mg per capsule
Pack Size: 60 capsules
Manufacturer: Peptide Sciences USA
Brand Name: Peptide Blend
Molecular Formulas: BPC-157 (C₆₂H₉₈N₁₆O₂₂), KPV (C₁₆H₃₀N₄O₄), PEA (C₁₈H₃₇NO₂), Tributyrin (C₁₅H₂₆O₆)
Molecular Weights: BPC-157 (~1419 g/mol), KPV (342.43 g/mol), PEA (299.49 g/mol), Tributyrin (302.36 g/mol)

Peptide Sciences USA

Hexarelin 2 mg

Active Substance: Hexarelin
Concentration: 2 mg per vial
Pack Size: Single vial (lyophilized powder)
Manufacturer: Peptide Sciences USA
Brand Name: Hexarelin
Molecular Formula: C₄₇H₅₈N₁₂O₆
Molecular Weight: 887.04 g/mol
Sequence: His-D-2-Me-Trp-Ala-Trp-D-Phe-Lys-NH2
Synonyms: Growth Hormone Secretagogue, Examorelin

Peptide Sciences USA

Hexarelin 5 mg

Active Substance: Hexarelin
Concentration: 5 mg per vial
Pack Size: Single vial (lyophilized powder)
Manufacturer: Peptide Sciences USA
Brand Name: Hexarelin
Molecular Formula: C₄₇H₅₈N₁₂O₆
Molecular Weight: 887.04 g/mol
Sequence: His-D-2-Me-Trp-Ala-Trp-D-Phe-Lys-NH2
Synonyms: Growth Hormone Secretagogue, Examorelin

Peptide Sciences USA

hGH Fragment 176-191 6 mg

Active Substance: Growth Hormone Peptide Fragment 176-191
Concentration: 6 mg per vial
Pack Size: Single vial (lyophilized powder)
Manufacturer: Peptide Sciences USA
Brand Name: Fragment HGH
Molecular Formula: C₇₈H₁₂₅N₂₀O₂₃S
Molecular Weight: ~1817 g/mol
Sequence: Tyr-Leu-Arg-Ile-Val-Gln-Cys-Arg-Ser-Val-Glu-Gly-Ser-Cys-Gly-Phe
Synonyms: hGH Fragment, AOD9604

Peptide Sciences USA

Humanin 10 mg

Active Substance: Humanin
Concentration: 10 mg per vial
Pack Size: Single vial (lyophilized powder)
Manufacturer: Peptide Sciences USA
Brand Name: Humanin
Molecular Formula: C₁₁₉H₂₀₄N₃₄O₃₂S
Molecular Weight: ~2687 g/mol
Sequence: Met-Ala-Pro-Arg-Gly-Phe-Ser-Cys-Leu-Leu-Leu-Leu-Thr-Ser-Glu-Ile-Asp-Leu-Pro-Val-Lys-Arg-Arg-Ala
Synonyms: Mitochondrial-Derived Peptide, HN

Peptide Sciences USA

IGF-1 DES 1 mg

Active Substance: Insulin-Like Growth Factor 1, DES
Concentration: 1 mg per vial
Pack Size: Single vial (lyophilized powder)
Manufacturer: Peptide Sciences USA
Brand Name: IGF-1 DES
Molecular Formula: C₃₁₉H₅₀₁N₉₁O₉₆S₇
Molecular Weight: ~7377 g/mol
Sequence: TLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
Synonyms: DES(1-3)IGF-1, Truncated IGF-1

Peptide Sciences USA

IGF-1-LR3 1 mg

Active Substance: Insulin-like Growth Factor 1, Long R3
Concentration: 1 mg per vial
Pack Size: Single vial (lyophilized powder)
Manufacturer: Peptide Sciences USA
Brand Name: IGF-1 LR3
Molecular Formula: C₄₀₀H₆₂₅N₁₁₁O₁₁₅S₉
Molecular Weight: 9117.5 g/mol
Sequence: MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
Synonyms: Long R3 IGF-1, LR3-IGF-1

Peptide Sciences USA

Ipamorelin 10 mg

Active Substance: Ipamorelin
Concentration: 10 mg per vial
Pack Size: Single vial (lyophilized powder)
Manufacturer: Peptide Sciences USA
Brand Name: Ipamorelin
Molecular Formula: C₃₈H₄₉N₉O₅
Molecular Weight: 711.85 g/mol
Sequence: Aib-His-D-2-Nal-D-Phe-Lys-NH2
Synonyms: Growth Hormone Secretagogue, GHRP

Peptide Sciences USA

Ipamorelin 5 mg

Active Substance: Ipamorelin
Concentration: 5 mg per vial
Pack Size: Single vial (lyophilized powder)
Manufacturer: Peptide Sciences USA
Brand Name: Ipamorelin
Molecular Formula: C₃₈H₄₉N₉O₅
Molecular Weight: 711.85 g/mol
Sequence: Aib-His-D-2-Nal-D-Phe-Lys-NH2
Synonyms: Growth Hormone Secretagogue, GHRP

Peptide Sciences USA

Ipamorelin 2 mg

Active Substance: Ipamorelin
Concentration: 2 mg per vial
Pack Size: Single vial (lyophilized powder)
Manufacturer: Peptide Sciences USA
Brand Name: Ipamorelin
Molecular Formula: C₃₈H₄₉N₉O₅
Molecular Weight: 711.85 g/mol
Sequence: Aib-His-D-2-Nal-D-Phe-Lys-NH2
Synonyms: Growth Hormone Secretagogue, GHRP

Peptide Sciences USA

Kisspeptin-10 5 mg

Active Substance: Metastin (Kisspeptin-10)
Concentration: 5 mg per vial
Pack Size: Single vial (lyophilized powder)
Manufacturer: Peptide Sciences USA
Brand Name: Kisspeptin
Molecular Formula: C₆₃H₈₃N₁₇O₁₄
Molecular Weight: 1302.4 g/mol
Sequence: Tyr-Asn-Trp-Asn-Ser-Phe-Gly-Leu-Arg-Phe-NH2
Synonyms: Kp-10, Kisspeptin, Metastin

Peptide Sciences USA

KPV 5 mg

Active Substance: Lysine-Proline-Valine (KPV)
Concentration: 5 mg per vial
Pack Size: Single vial (lyophilized powder)
Manufacturer: Peptide Sciences USA
Brand Name: KPV
Molecular Formula: C₁₆H₃₀N₄O₄
Molecular Weight: 342.43 g/mol
Sequence: Lys-Pro-Val
Synonyms: α-MSH(11-13), Melanocortin Tripeptide

Peptide Sciences USA

L-Glutathione 600 mg

Active Substance: Glutathione (L-Glutathione)
Concentration: 600 mg per vial
Pack Size: Single vial (lyophilized powder)
Manufacturer: Peptide Sciences USA
Brand Name: Glutathione
Molecular Formula: C₁₀H₁₇N₃O₆S
Molecular Weight: 307.32 g/mol
Sequence: γ-L-Glu-L-Cys-Gly
Synonyms: GSH, Reduced Glutathione

Peptide Sciences USA

Lipopeptide 200 mg

Active Substance: Lipopeptide (Pal-Gly-Gln-Pro-Arg)
Concentration: 200 mg
Pack Size: Topical formulation (cream or serum)
Manufacturer: Peptide Sciences USA
Brand Name: Lipopeptide
Molecular Formula: C₃₈H₆₈N₆O₈
Molecular Weight: 736.98 g/mol
Sequence: Pal-Gly-Gln-Pro-Arg
Synonyms: Pal-GQPR, Palmitoyl Tetrapeptide-7/3, Biopeptide EL

Peptide Sciences USA

Livagen 20 mg

Active Substance: Livagen (Lys-Glu-Asp-Ala)
Concentration: 20 mg per vial
Pack Size: Single vial (lyophilized powder)
Manufacturer: Peptide Sciences USA
Brand Name: Livagen
Molecular Formula: C₁₈H₃₁N₅O₉
Molecular Weight: 461.5 g/mol
Sequence: Lys-Glu-Asp-Ala
Synonyms: KEDA, Bioregulatory Tetrapeptide

Peptide Sciences USA

LL-37 5 mg

Active Substance: LL-37 (Cathelicidin)
Concentration: 5 mg per vial
Pack Size: Single vial (lyophilized powder)
Manufacturer: Peptide Sciences USA
Brand Name: LL-37
Molecular Formula: C₂₀₅H₃₄₀N₆₀O₅₃
Molecular Weight: 4493.3 g/mol
Sequence: [LL-37, 37 aa]
Synonyms: Cathelicidin, hCAP-18 (C-terminal)

Peptide Sciences USA

Longevity - Performance & Obesity Research

Active Substances: 5-amino-1MQ (50 mg/capsule), NMN (50 mg/capsule), JBSNF-000088 (5 mg/capsule)
Concentration: 105 mg per capsule
Pack Size: 60 capsules
Manufacturer: Peptide Sciences USA
Brand Name: Peptide Blend
Molecular Formulas: 5-amino-1MQ (C₁₀H₁₁N₂), NMN (C₁₁H₁₅N₂O₈P), JBSNF-000088 (C₇H₈N₂O)
Molecular Weights: 5-amino-1MQ (159.21 g/mol), NMN (334.22 g/mol), JBSNF-000088 (136.15 g/mol)
Synonyms: 5-amino-1-methylquinolinium, Nicotinamide Mononucleotide, 6-Methoxynicotinamide