Healing & Recovery Peptides
Filters
Filters
Peptides By Research Purpose
Filter By Price
$
$
Brands
Substances
Manufacturers
Shipping Location
Default
Default
Price, low to high
Price, high to low
Duo-Blend Mod GRF / Ipamorelin 10 mg
- Active Substance: Modified GRF (CJC-1295 No DAC) and Ipamorelin (5 mg each)
- Concentration: 10 mg per vial (5 mg Mod GRF + 5 mg Ipamorelin)
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: Peptide Blend
- Molecular Formula (Mod GRF): C152H252N44O42
- Molecular Weight (Mod GRF): 3367.97 g/mol
- Sequence (Mod GRF): H-Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-Ser-Arg-NH2
- Molecular Formula (Ipamorelin): C38H49N9O5
- Molecular Weight (Ipamorelin): 711.85 g/mol
- Sequence (Ipamorelin): Aib-His-D-2-Nal-D-Phe-Lys-NH2
- Synonyms: Mod GRF (CJC-1295 No DAC, Sermorelin analog), Ipamorelin (GHRP, Ghrelin mimetic)
Out of Stock
Duo-Blend Sermorelin / GHRP-2 10 mg
- Active Substance: Sermorelin (Mod GRF, GHRH 1-29) and GHRP-2 (5 mg each)
- Concentration: 10 mg per vial (5 mg Sermorelin + 5 mg GHRP-2)
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: Peptide Blend
- Molecular Formula (Sermorelin): C149H246N44O42S
- Molecular Weight (Sermorelin): 3357.93 g/mol
- Sequence (Sermorelin): Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-NH2
- Molecular Formula (GHRP-2): C45H55N9O6
- Molecular Weight (GHRP-2): 818.0 g/mol
- Sequence (GHRP-2): D-Ala-D-2-Nal-Ala-Trp-D-Phe-Lys-NH2
- Synonyms: Sermorelin (GHRH 1-29, Mod GRF), GHRP-2 (Pralmorelin)
Out of Stock
Duo-Blend Sermorelin / GHRP-6 10 mg
- Active Substance: Sermorelin (GHRH 1-29) and GHRP-6 (5 mg each)
- Concentration: 10 mg per vial (5 mg Sermorelin + 5 mg GHRP-6)
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: Peptide Blend
- Molecular Formula (Sermorelin): C149H246N44O42S
- Molecular Weight (Sermorelin): 3357.93 g/mol
- Sequence (Sermorelin): Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-NH2
- Molecular Formula (GHRP-6): C46H56N12O6
- Molecular Weight (GHRP-6): 873.01 g/mol
- Sequence (GHRP-6): His-D-Trp-Ala-Trp-D-Phe-Lys-NH2
- Synonyms: Sermorelin (GHRH 1-29, Mod GRF), GHRP-6 (Growth Hormone-Releasing Hexapeptide)
Out of Stock
Duo-Blend Tesamorelin / Ipamorelin 8 mg
- Active Substance: Tesamorelin (6 mg) and Ipamorelin (2 mg)
- Concentration: 8 mg per vial (6 mg Tesamorelin + 2 mg Ipamorelin)
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: Peptide Blend
- Molecular Formula (Tesamorelin): C221H366N72O67S
- Molecular Weight (Tesamorelin): 5135.86 g/mol
- Sequence (Tesamorelin): Unk-Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-Gln-Gln-Gly-Glu-Ser-Asn-Gln-Glu-Arg-Gly-Ala-Arg-Ala-Arg-Leu-NH2
- Molecular Formula (Ipamorelin): C38H49N9O5
- Molecular Weight (Ipamorelin): 711.85 g/mol
- Sequence (Ipamorelin): Aib-His-D-2-Nal-D-Phe-Lys-NH2
- Synonyms: Tesamorelin (Egrifta, TH9507), Ipamorelin (GHRP, Ghrelin mimetic)
Out of Stock
Fragment / Modified GRF / Ipamorelin 12 mg
- Active Substance: HGH Fragment 176-191 (6 mg), Modified GRF (CJC-1295 No DAC, 3 mg), Ipamorelin (3 mg)
- Concentration: 12 mg per vial (6 mg HGH Fragment 176-191 + 3 mg Modified GRF + 3 mg Ipamorelin)
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: Peptide Blend
- Molecular Formula (HGH Fragment 176-191): C78H125N24O24S2
- Molecular Weight (HGH Fragment 176-191): 1817.12 g/mol
- Sequence (HGH Fragment 176-191): Tyr-Leu-Arg-Ile-Val-Gln-Cys-Arg-Ser-Val-Glu-Gly-Ser-Cys-Gly-Phe
- Molecular Formula (Modified GRF): C152H252N44O42
- Molecular Weight (Modified GRF): 3367.97 g/mol
- Sequence (Modified GRF): H-Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-Ser-Arg-NH2
- Molecular Formula (Ipamorelin): C38H49N9O5
- Molecular Weight (Ipamorelin): 711.85 g/mol
- Sequence (Ipamorelin): Aib-His-D-2-Nal-D-Phe-Lys-NH2
- Synonyms: HGH Fragment 176-191 (AOD9604), Modified GRF (CJC-1295 No DAC), Ipamorelin (GHRP, Ghrelin mimetic)
Out of Stock
Fragment / CJC1295 / Ipamorelin 12 mg
- Active Substance: HGH Fragment 176-191 (6 mg), CJC1295 No DAC (3 mg), Ipamorelin (3 mg)
- Concentration: 12 mg per vial (6 mg HGH Fragment 176-191 + 3 mg CJC1295 + 3 mg Ipamorelin)
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: Peptide Blend
- Molecular Formula (HGH Fragment 176-191): C78H125N24O24S2
- Molecular Weight (HGH Fragment 176-191): 1817.12 g/mol
- Sequence (HGH Fragment 176-191): Tyr-Leu-Arg-Ile-Val-Gln-Cys-Arg-Ser-Val-Glu-Gly-Ser-Cys-Gly-Phe
- Molecular Formula (CJC1295 No DAC): C152H252N44O42
- Molecular Weight (CJC1295 No DAC): 3367.97 g/mol
- Sequence (CJC1295 No DAC): H-Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-Ser-Arg-NH2
- Molecular Formula (Ipamorelin): C38H49N9O5
- Molecular Weight (Ipamorelin): 711.85 g/mol
- Sequence (Ipamorelin): Aib-His-D-2-Nal-D-Phe-Lys-NH2
- Synonyms: HGH Fragment 176-191 (AOD9604), CJC1295 No DAC (Mod GRF), Ipamorelin (GHRP, Ghrelin mimetic)
Out of Stock
GHK-Cu 500 mg
- Active Substance: Glycyl-L-Histidyl-L-Lysine Copper Complex (GHK-Cu)
- Concentration: 500 mg per container
- Pack Size: Single container (lyophilized powder for topical formulation)
- Manufacturer: Peptide Sciences USA
- Brand Name: GHK-Cu
- Molecular Formula: C14H22N6O4Cu
- Molecular Weight: ~403 g/mol
- Sequence: Gly-His-Lys-Cu
- Synonyms: Copper Tripeptide-1, GHK Copper Peptide
Out of Stock
GHRH 5 mg
- Active Substance: Growth Hormone–Releasing Hormone (Sermorelin analog)
- Concentration: 5 mg per vial
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: Somatoliberin
- Molecular Formula: C149H246N44O42S
- Molecular Weight: 3357.93 g/mol
- Sequence: Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-NH2
- Synonyms: Somatoliberin, Sermorelin, GHRH 1-29
Out of Stock
GHRP-2 5 mg
- Active Substance: Growth Hormone-Releasing Peptide 2 (GHRP-2)
- Concentration: 5 mg per vial
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: GHRP-2
- Molecular Formula: C45H55N9O6
- Molecular Weight: 818.0 g/mol
- Sequence: D-Ala-D-2-Nal-Ala-Trp-D-Phe-Lys-NH2
- Synonyms: Pralmorelin, Growth Hormone Secretagogue
Out of Stock
Gonadorelin 10 mg
- Active Substance: Gonadotropin-Releasing Hormone (Gonadorelin)
- Concentration: 10 mg per vial
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: Gonadorelin
- Molecular Formula: C55H75N17O13
- Molecular Weight: 1182.29 g/mol
- Sequence: pGlu-His-Trp-Ser-Tyr-Gly-Leu-Arg-Pro-Gly-NH2
- Synonyms: GnRH, LHRH, Gonadotropin-Releasing Hormone
Out of Stock
Gut Inflammation
- Active Substances: Stable BPC-157 (Arginate Salt, 500 mcg), KPV (500 mcg), PEA (400 mg), Tributyrin (400 mg)
- Concentration: 801 mg per capsule
- Pack Size: 60 capsules
- Manufacturer: Peptide Sciences USA
- Brand Name: Peptide Blend
- Molecular Formulas: BPC-157 (C62H98N16O22), KPV (C16H30N4O4), PEA (C18H37NO2), Tributyrin (C15H26O6)
- Molecular Weights: BPC-157 (~1419 g/mol), KPV (342.43 g/mol), PEA (299.49 g/mol), Tributyrin (302.36 g/mol)
Out of Stock
Hexarelin 5 mg
- Active Substance: Hexarelin
- Concentration: 5 mg per vial
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: Hexarelin
- Molecular Formula: C47H58N12O6
- Molecular Weight: 887.04 g/mol
- Sequence: His-D-2-Me-Trp-Ala-Trp-D-Phe-Lys-NH2
- Synonyms: Growth Hormone Secretagogue, Examorelin
Out of Stock
IGF-1-LR3 1 mg
- Active Substance: Insulin-like Growth Factor 1, Long R3
- Concentration: 1 mg per vial
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: IGF-1 LR3
- Molecular Formula: C400H625N111O115S9
- Molecular Weight: 9117.5 g/mol
- Sequence: MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
- Synonyms: Long R3 IGF-1, LR3-IGF-1
Out of Stock
Ipamorelin 10 mg
- Active Substance: Ipamorelin
- Concentration: 10 mg per vial
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: Ipamorelin
- Molecular Formula: C38H49N9O5
- Molecular Weight: 711.85 g/mol
- Sequence: Aib-His-D-2-Nal-D-Phe-Lys-NH2
- Synonyms: Growth Hormone Secretagogue, GHRP
Out of Stock
KPV 5 mg
- Active Substance: Lysine-Proline-Valine (KPV)
- Concentration: 5 mg per vial
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: KPV
- Molecular Formula: C16H30N4O4
- Molecular Weight: 342.43 g/mol
- Sequence: Lys-Pro-Val
- Synonyms: α-MSH(11-13), Melanocortin Tripeptide
Out of Stock
LL-37 5 mg
- Active Substance: LL-37 (Cathelicidin)
- Concentration: 5 mg per vial
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: LL-37
- Molecular Formula: C205H340N60O53
- Molecular Weight: 4493.3 g/mol
- Sequence: LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES
- Synonyms: Cathelicidin, hCAP-18 (C-terminal)
Out of Stock
MGF IGF-1 Ec 5 mg
- Active Substance: Mechano Growth Factor (IGF-1Ec)
- Concentration: 5 mg per vial
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: MGF
- Molecular Formula: C124H204N42O41S1
- Molecular Weight: 2971.99 g/mol
- Sequence: Tyr-Gln-Pro-Pro-Ser-Thr-Asn-Lys-Asn-Thr-Lys-Ser-Gln-Arg-Arg-Lys-Gly-Ser-Thr-Phe-Glu-Glu-Arg-Lys-Cys
- Synonyms: Mechano Growth Factor, IGF-1Eb, MGF-24aa-E
Out of Stock
MK-677 (Ibutamoren) 12.5 mg
- Active Substance: Ibutamoren (MK-677)
- Concentration: 12.5 mg per capsule
- Pack Size: 60 capsules
- Manufacturer: Peptide Sciences USA
- Brand Name: Ibutamoren
- Molecular Formula: C27H36N4O5S
- Molecular Weight: 528.7 g/mol
- Synonyms: MK-0677, Oratrope, L-163,191
Out of Stock
MOTS-c 10 mg
- Active Substance: MOTS-c (Mitochondrial-Derived Peptide)
- Concentration: 10 mg per vial
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: MOTS-c
- Molecular Formula: C74H115N23O23S2
- Molecular Weight: 1718.97 g/mol
- Sequence: Met-Arg-Trp-Gln-Glu-Met-Gly-Tyr-Ile-Phe-Tyr-Pro-Arg-Lys-Leu-Arg
- Synonyms: Mitochondrial ORF of the 12S rRNA-c, MDP
Out of Stock
MOTS-c 5 mg
- Active Substance: MOTS-c (Mitochondrial-Derived Peptide)
- Concentration: 5 mg per vial
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: MOTS-c
- Molecular Formula: C74H115N23O23S2
- Molecular Weight: 1718.97 g/mol
- Sequence: Met-Arg-Trp-Gln-Glu-Met-Gly-Tyr-Ile-Phe-Tyr-Pro-Arg-Lys-Leu-Arg
- Synonyms: Mitochondrial ORF of the 12S rRNA-c, MDP
Out of Stock
Out Of Stock
Out Of Stock
Out Of Stock
Out Of Stock
Out Of Stock
Out Of Stock
Out Of Stock
Out Of Stock
Out Of Stock
Out Of Stock
Out Of Stock
Out Of Stock
Out Of Stock
Out Of Stock
Out Of Stock
Out Of Stock
Out Of Stock
Out Of Stock
Out Of Stock
Out Of Stock