Injectable Peptides
Filters
Filters
Peptides by Form
Filter By Price
$
$
Brands
Substances
Manufacturers
Shipping Location
Default
Default
Price, low to high
Price, high to low
TB-500 10 mg
- Active Substance: Thymosin Beta-4 (TB-500)
- Concentration: 10 mg per vial
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: TB-500
- Molecular Formula: C38H65N11O14
- Molecular Weight: 889.0 g/mol
- Sequence: Ac-LKKTETQ
- Synonyms: TB-500, Thymosin Beta-4 Fragment, Fequesetide
Out of Stock
TB-500 2 mg
- Active Substance: Thymosin Beta-4 (TB-500)
- Concentration: 2 mg per vial
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: TB-500
- Categories: Injectable Peptides, Healing & Recovery Peptides, Muscle Growth Peptides, Immune & Longevity Support Peptides
- Molecular Formula: C212H350N56O78S
- Molecular Weight: 4963.49 g/mol
- Sequence: SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
- Synonyms: Thymosin Beta-4, TB500
Out of Stock
TB-500 5 mg
- Active Substance: Thymosin Beta-4 (TB-500)
- Concentration: 5 mg per vial
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: TB-500
- Molecular Formula: C212H350N56O78S
- Molecular Weight: 4963.49 g/mol
- Synonyms: Thymosin Beta-4, TB500
Out of Stock
TB-500 Fragment (17-23) 10 mg
- Active Substance: TB-500 Fragment (17-23) (Fequesetide)
- Concentration: 10 mg per vial
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: TB-500
- Molecular Formula: C38H65N11O14
- Molecular Weight: 889.0 g/mol
- Sequence: Ac-LKKTETQ
- Synonyms: TB-500 Fragment, Fequesetide, Thymosin Beta-4 (17-23)
Out of Stock
Tesamorelin / CJC1295 / Ipamorelin 12 mg
- Active Substances: Tesamorelin, CJC-1295 (Mod GRF 1-29, no DAC), Ipamorelin
- Concentration: 12 mg per vial (6 mg Tesamorelin, 3 mg CJC-1295, 3 mg Ipamorelin)
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: Peptide Blend
- Synonyms: Tesamorelin / CJC-1295 / Ipamorelin Blend, GHRH/GHRP Blend
Out of Stock
Testagen 20 mg
- Active Substance: Testagen (Bioregulatory Tetrapeptide)
- Concentration: 20 mg per vial
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: Testagen
- Molecular Formula: C17H29N5O9
- Molecular Weight: 447.2 g/mol
- Sequence: Lys-Glu-Asp-Gly
- Synonyms: Testagen, KEDG, Anterior Pituitary Peptide (APP)
Out of Stock
Thymagen 20 mg
- Active Substance: Thymogen Alpha-1 (Glu-Trp, Lys-Glu)
- Concentration: 20 mg per vial
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: Thymogen
- Synonyms: Thymogen Alpha-1, Thymogen, Oglufanide
Out of Stock
Thymalin 20 mg
- Active Substance: Thymogen Alpha-1 (Glu-Trp, Lys-Glu)
- Concentration: 20 mg per vial
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: Thymogen
- Molecular Formula (Thymogen): C16H19N3O5
- Molecular Weight (Thymogen): 333.34 g/mol
- Molecular Formula (Immune Peptide A2): C11H20N2O5
- Molecular Weight (Immune Peptide A2): 260.29 g/mol
- Sequence (Thymogen): Glu-Trp
- Sequence (Immune Peptide A2): Lys-Glu
- Synonyms: Thymogen Alpha-1, Thymogen, Oglufanide
Out of Stock
Thymalin 50 mg
- Active Substance: Thymalin
- Concentration: 50 mg per vial
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: Thymalin
- Molecular Formula: Not fully defined – peptide complex derived from thymus extract
- Molecular Weight: Approx. 900–1200 Da (varies)
- Sequence: Peptide fractions with immune-regulatory activity (specific sequence not disclosed)
- Synonyms: Thymus Extract Peptide, Thymic Peptide Complex
Out of Stock
Thymosin Alpha-1 10 mg
- Active Substance: Thymosin Alpha-1
- Concentration: 10 mg per vial
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: Thymosin
- Molecular Formula: C129H215N33O55
- Molecular Weight: 3108.3 g/mol
- Synonyms: TA1, Zadaxin, Immune Modulator Peptide
Out of Stock
Thymosin Alpha-1 3 mg
- Active Substance: Thymosin Alpha-1
- Concentration: 3 mg per vial
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: Thymosin
- Molecular Formula: C129H215N33O55
- Molecular Weight: 3108.3 g/mol
- Synonyms: Thymalfasin, Zadaxin, Tα1
Out of Stock
Tirzepatide 5 mg
- Concentration: 5 mg per vial
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: Tirzepatide
- Molecular Formula: C225H348N56O67
- Molecular Weight: 4813.5 g/mol
- Synonyms: LY3298176, Dual Incretin Agonist Peptide
Out of Stock
Tripeptide-29 200 mg
- Concentration: 200 mg per vial
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: Tripeptide-29
- Molecular Formula: C10H16N2O5
- Molecular Weight: 244.25 g/mol
- Sequence: Glycine-Proline-Hydroxyproline (Gly–Pro–Hyp)
- Synonyms: Collagen Tripeptide, GPH Tripeptide, Tripeptide-29
Out of Stock
Triptorelin (GnRH) 2 mg
- Active Substance: Triptorelin
- Concentration: 2 mg per vial
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: Trelstar
- Molecular Formula: C64H82N18O13
- Molecular Weight: 1311.45 g/mol
- Sequence: pGlu-His-Trp-Ser-Tyr-D-Trp-Leu-Arg-Pro-Gly-NH2
- Synonyms: GnRH Agonist, Trelstar, Decapeptyl, Triptorelin Acetate
Out of Stock
Vesilute 20 mg
- Active Substance: Vesilute
- Concentration: 20 mg per vial
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Molecular Weight: Variable – peptide complex
- Sequence: Tissue-specific peptide fractions derived from bladder epithelium
- Synonyms: Vesugen, Cytogenetic Bladder Peptide, Vesilute Complex
Out of Stock
Vilon 20 mg
- Active Substance: Vilon
- Concentration: 20 mg per vial
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: Vilon
- Molecular Formula: C10H14N2O5
- Molecular Weight: 242.23 g/mol
- Sequence: Glu-Asp-Ala
- Synonyms: Thymus Cytogenetic Peptide, Vilon Peptide, Immune Bioregulator
Out of Stock
Sermorelin 5 mg
- Active Substance: Sermorelin
- Concentration: 5 mg per vial
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: Sermorelin
- Molecular Formula: C149H246N44O42S
- Molecular Weight: 3357.96 g/mol
- Synonyms: GHRH 1–29, Sermorelin Acetate, Growth Hormone-Releasing Factor analog
Out of Stock
Pancragen 20 mg
- Active Substance: Pancragen
- Concentration: 20 mg per vial
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: Pancragen
- Synonyms: Pancreatic Cytogenetic Peptide, Pancreatic Bioregulator, Peptide Biocomplex
Out of Stock
CJC-1295 / GHRP-2 10 mg
- Active Substance: Thyrotropin Releasing Hormone
- Concentration: 50 mg per vial
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: Protirelin
- Molecular Formula: C16H22N6O4
- Molecular Weight: 362.38 g/mol
- Sequence: pGlu-His-Pro-NH2
- Synonyms: Protirelin, TRH, Thyroliberin
Out of Stock
HCG 2500IU
- Active Substance: Human Chorionic Gonadotropin (HCG)
- Concentration: 2500 IU
- Pack Size: Full kit (1 vial + diluent)
- Manufacturer: Dragon Pharma
- Brand Name: Pregnyl
- Molecular Formula: C1107H1770N318O336S26
- Molecular Weight: ~36.7 kDa
- Synonyms: hCG, Chorionic Gonadotropin, Human LH Mimetic
Out of Stock
Out Of Stock
Out Of Stock
Out Of Stock
Out Of Stock
Out Of Stock
Out Of Stock
Out Of Stock
Out Of Stock
Out Of Stock
Out Of Stock
Out Of Stock
Out Of Stock
Out Of Stock
Out Of Stock
Out Of Stock
Out Of Stock
Out Of Stock
Out Of Stock
Out Of Stock
Out Of Stock