Home
Peptides by Form
Peptides by Form
Filters
Filters
Peptides by Form
Filter By Price
$
$
Brands
Substances
Manufacturers
Shipping Location
Default
Default
Price, low to high
Price, high to low
BPC-157/TB-500 20 mg Blend
- Active Substance: Thymosin beta 4 / Pentadecapeptide (10 mg BPC-157 + 10 mg TB-500)
- Concentration: 20 mg per vial (10 mg each peptide)
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Molecular Formula (BPC-157): C62H98N16O22
- Molecular Weight (BPC-157): 1419.54 g/mol
- Sequence (BPC-157): Gly-Glu-Pro-Pro-Pro-Gly-Lys-Pro-Ala-Pro-Pro-Ala-Glu-Gly-Lys
- Molecular Formula (TB-500): C38H68N10O14
- Molecular Weight (TB-500): 889.01 g/mol
- Sequence (TB-500): Ac-LKKTETQ
- Synonyms: BPC-157 (Body Protection Compound-157), TB-500 (Thymosin Beta-4 fragment)
Out of Stock
BPC-157/TB-500/GHK-Cu 30 mg
- Active Substance: Thymosin beta 4 / Pentadecapeptide / GHK-Cu (10 mg BPC-157 + 10 mg TB-500 + 10 mg GHK-Cu)
- Concentration: 30 mg per vial (10 mg each peptide)
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: Peptide Blend
- Molecular Formula (BPC-157): C62H98N16O22
- Molecular Weight (BPC-157): 1419.54 g/mol
- Sequence (BPC-157): Gly-Glu-Pro-Pro-Pro-Gly-Lys-Pro-Ala-Pro-Pro-Ala-Glu-Gly-Lys
- Molecular Formula (TB-500): C38H68N10O14
- Molecular Weight (TB-500): 889.01 g/mol
- Sequence (TB-500): Ac-LKKTETQ
- Molecular Formula (GHK-Cu): C14H24CuN6O4
- Molecular Weight (GHK-Cu): 340.87 g/mol (excluding copper)
- Sequence (GHK-Cu): Glycyl-Histidyl-Lysine
- Synonyms: BPC-157 (Body Protection Compound-157), TB-500 (Thymosin Beta-4 fragment), GHK-Cu (Copper Tripeptide-1)
Out of Stock
Bronchogen 20 mg
- Active Substance: Bronchogen
- Concentration: 20 mg per vial
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: Bronchogen
- Molecular Formula: C18H30N4O9
- Molecular Weight: 446.45 g/mol
- Sequence: Ala-Glu-Asp-Leu
- Synonyms: AEDL, Bronchial Peptide Bioregulator
Out of Stock
Cagrilintide 10 mg
- Active Substance: Cagrilintide
- Concentration: 10 mg per vial
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: Cagrilintide
- Molecular Formula: C194H312N54O59S2.xC2H4O2
- Molecular Weight: 4409.01 g/mol
- Sequence: XKCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP
- Synonyms: AM833, AT42613
Out of Stock
Cardiogen 20 mg
- Active Substance: Cardiogen
- Concentration: 20 mg per vial
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: Cardiogen
- Molecular Formula: C18H31N7O9
- Molecular Weight: 489.5 g/mol
- Sequence: Ala-Glu-Asp-Arg
Out of Stock
Cartalax 20 mg
- Active Substance: Cartalax
- Concentration: 20 mg per vial
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: Cartalax
- Molecular Formula: C12H19N3O8
- Molecular Weight: 333.29 g/mol
- Sequence: Ala-Glu-Asp
- Synonyms: AED, T-31, SCHEMBL5324601
Out of Stock
Chonluten 20 mg
- Active Substance: Chonluten
- Concentration: 20 mg per vial
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: Chonluten
- Molecular Formula: C11H17N3O8
- Molecular Weight: 319.27 g/mol
- Sequence: Glu-Asp-Gly
- Synonyms: Tripeptide T-34, EDG, AC-7
Out of Stock
CJC-1295 (No DAC) / Ipamorelin 10 mg
- Active Substance: Duo-Blend CJC-1295 No DAC and Ipamorelin (5 mg each)
- Concentration: 10 mg per vial (5 mg CJC-1295 No DAC + 5 mg Ipamorelin)
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: Peptide Blend
- Molecular Formula (CJC-1295 No DAC): C152H252N44O42
- Molecular Weight (CJC-1295 No DAC): 3367.97 g/mol
- Sequence (CJC-1295 No DAC): H-Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-Ser-Arg-NH2
- Molecular Formula (Ipamorelin): C38H49N9O5
- Molecular Weight (Ipamorelin): 711.85 g/mol
- Sequence (Ipamorelin): Aib-His-D-2-Nal-D-Phe-Lys-NH2
- Synonyms: CJC-1295 No DAC (Modified GRF 1-29, Sermorelin analog), Ipamorelin (GHRP, Ghrelin mimetic)
Out of Stock
CJC-1295 / GHRP-6 10 mg
- Product Title: CJC-1295 / GHRP-2 10 mg
- Active Substance: Tetrasubstituted 30-Amino Acid Peptide Hormone / Growth Hormone-Releasing Peptide 2 (5 mg CJC-1295 No DAC + 5 mg GHRP-2)
- Concentration: 10 mg per vial (5 mg each peptide)
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: Peptide Blend
- Molecular Formula (CJC-1295 No DAC): C152H252N44O42
- Molecular Weight (CJC-1295 No DAC): 3367.97 g/mol
- Sequence (CJC-1295 No DAC): H-Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-Ser-Arg-NH2
- Molecular Formula (GHRP-2): C45H55N9O6
- Molecular Weight (GHRP-2): 818.0 g/mol
- Sequence (GHRP-2): D-Ala-D-2-Nal-Ala-Trp-D-Phe-Lys-NH2
- Synonyms: CJC-1295 No DAC (Modified GRF 1-29, Sermorelin analog), GHRP-2 (Pralmorelin, Growth Hormone-Releasing Peptide-2)
Out of Stock
CJC-1295 / Hexarelin 10 mg
- Product Title: CJC-1295 / Hexarelin 10 mg
- Active Substance: Duo-Blend CJC-1295 No DAC and Hexarelin (5 mg each)
- Concentration: 10 mg per vial (5 mg CJC-1295 No DAC + 5 mg Hexarelin)
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: Peptide Blend
- Molecular Formula (CJC-1295 No DAC): C152H252N44O42
- Molecular Weight (CJC-1295 No DAC): 3367.97 g/mol
- Sequence (CJC-1295 No DAC): H-Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-Ser-Arg-NH2
- Molecular Formula (Hexarelin): C47H58N12O6
- Molecular Weight (Hexarelin): 887.04 g/mol
- Sequence (Hexarelin): His-D-2-methyl-Trp-Ala-Trp-D-Phe-Lys-NH2
- Synonyms: CJC-1295 No DAC (Modified GRF 1-29, Sermorelin analog), Hexarelin (Examorelin, Growth Hormone-Releasing Hexapeptide)
Out of Stock
CJC-1295 no DAC 2 mg
- Active Substance: CJC-1295 No DAC
- Concentration: 2 mg per vial
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: Mod GRF (1-29)
- Molecular Formula: C152H252N44O42
- Molecular Weight: 3367.97 g/mol
- Sequence: H-Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-Ser-Arg-NH2
- Synonyms: Modified GRF (1-29), Sermorelin analog
Out of Stock
CJC1295 / Ipamorelin / GHRP-2
- Active Substance: CJC-1295 DAC / Ipamorelin / GHRP-2 (3 mg each)
- Concentration: 9 mg per vial (3 mg CJC-1295 DAC + 3 mg Ipamorelin + 3 mg GHRP-2)
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: Peptide Blend
- Molecular Formula (CJC-1295 DAC): C152H252N44O42 (with DAC modification)
- Molecular Weight (CJC-1295 DAC): ~3367.97 g/mol
- Sequence (CJC-1295 DAC): H-Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-Ser-Arg-Lys(Maleimidopropionyl)-NH2
- Molecular Formula (Ipamorelin): C38H49N9O5
- Molecular Weight (Ipamorelin): 711.85 g/mol
- Sequence (Ipamorelin): Aib-His-D-2-Nal-D-Phe-Lys-NH2
- Molecular Formula (GHRP-2): C45H55N9O6
- Molecular Weight (GHRP-2): 818.0 g/mol
- Sequence (GHRP-2): D-Ala-D-2-Nal-Ala-Trp-D-Phe-Lys-NH2
- Synonyms: CJC-1295 DAC (DAC:GRF), Ipamorelin (GHRP, Ghrelin mimetic), GHRP-2 (Pralmorelin)
Out of Stock
Cortagen 20 mg
- Active Substance: Cortagen
- Concentration: 20 mg per vial
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: Cortagen
- Molecular Formula: C17H27N5O8
- Molecular Weight: 430.17 g/mol
- Sequence: Ala-Glu-Asp-Pro
- Synonyms: AEDP, SCHEMBL5491754
Out of Stock
Decapeptide-12
- Product Title: Decapeptide-12
- Active Substance: Decapeptide-12
- Concentration: 200 mg
- Pack Size: Topical
- Manufacturer: Peptide Sciences USA
- Brand Name: Decapeptide
- Molecular Formula: C65H90N18O17
- Molecular Weight: 1311.46 g/mol
- Sequence: Tyr-Arg-Ser-Arg-Lys-Tyr-Ser-Ser-Trp-Tyr
- Synonyms: YRSRKYSSWY, Lumixyl
Out of Stock
DSIP 5 mg
- Active Substance: Delta-sleep-inducing peptide
- Concentration: 5 mg per vial
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: DSIP
- Molecular Formula: C35H48N10O15
- Molecular Weight: 848.81 g/mol
- Sequence: Trp-Ala-Gly-Gly-Asp-Ala-Ser-Gly-Glu
- Synonyms: Delta-sleep-inducing peptide, WAGGDASGE
Out of Stock
Duo-Blend Mod GRF / GHRP-2 10 mg
- Active Substance: Modified GRF (CJC-1295 No DAC) and GHRP-2 (5 mg each)
- Concentration: 10 mg per vial (5 mg Mod GRF + 5 mg GHRP-2)
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: Peptide Blend
- Molecular Formula (Mod GRF): C152H252N44O42
- Molecular Weight (Mod GRF): 3367.97 g/mol
- Sequence (Mod GRF): H-Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-Ser-Arg-NH2
- Molecular Formula (GHRP-2): C45H55N9O6
- Molecular Weight (GHRP-2): 818.0 g/mol
- Sequence (GHRP-2): D-Ala-D-2-Nal-Ala-Trp-D-Phe-Lys-NH2
- Synonyms: Mod GRF (CJC-1295 No DAC, Sermorelin analog), GHRP-2 (Pralmorelin)
Out of Stock
Duo-Blend Mod GRF / Ipamorelin 10 mg
- Active Substance: Modified GRF (CJC-1295 No DAC) and Ipamorelin (5 mg each)
- Concentration: 10 mg per vial (5 mg Mod GRF + 5 mg Ipamorelin)
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: Peptide Blend
- Molecular Formula (Mod GRF): C152H252N44O42
- Molecular Weight (Mod GRF): 3367.97 g/mol
- Sequence (Mod GRF): H-Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-Ser-Arg-NH2
- Molecular Formula (Ipamorelin): C38H49N9O5
- Molecular Weight (Ipamorelin): 711.85 g/mol
- Sequence (Ipamorelin): Aib-His-D-2-Nal-D-Phe-Lys-NH2
- Synonyms: Mod GRF (CJC-1295 No DAC, Sermorelin analog), Ipamorelin (GHRP, Ghrelin mimetic)
Out of Stock
Duo-Blend Sermorelin / GHRP-2 10 mg
- Active Substance: Sermorelin (Mod GRF, GHRH 1-29) and GHRP-2 (5 mg each)
- Concentration: 10 mg per vial (5 mg Sermorelin + 5 mg GHRP-2)
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: Peptide Blend
- Molecular Formula (Sermorelin): C149H246N44O42S
- Molecular Weight (Sermorelin): 3357.93 g/mol
- Sequence (Sermorelin): Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-NH2
- Molecular Formula (GHRP-2): C45H55N9O6
- Molecular Weight (GHRP-2): 818.0 g/mol
- Sequence (GHRP-2): D-Ala-D-2-Nal-Ala-Trp-D-Phe-Lys-NH2
- Synonyms: Sermorelin (GHRH 1-29, Mod GRF), GHRP-2 (Pralmorelin)
Out of Stock
Duo-Blend Sermorelin / GHRP-6 10 mg
- Active Substance: Sermorelin (GHRH 1-29) and GHRP-6 (5 mg each)
- Concentration: 10 mg per vial (5 mg Sermorelin + 5 mg GHRP-6)
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: Peptide Blend
- Molecular Formula (Sermorelin): C149H246N44O42S
- Molecular Weight (Sermorelin): 3357.93 g/mol
- Sequence (Sermorelin): Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-NH2
- Molecular Formula (GHRP-6): C46H56N12O6
- Molecular Weight (GHRP-6): 873.01 g/mol
- Sequence (GHRP-6): His-D-Trp-Ala-Trp-D-Phe-Lys-NH2
- Synonyms: Sermorelin (GHRH 1-29, Mod GRF), GHRP-6 (Growth Hormone-Releasing Hexapeptide)
Out of Stock
Duo-Blend Sermorelin / Ipamorelin 10 mg
- Active Substance: Sermorelin (GHRH 1-29) and Ipamorelin (5 mg each)
- Concentration: 10 mg per vial (5 mg Sermorelin + 5 mg Ipamorelin)
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: Peptide Blend
- Molecular Formula (Sermorelin): C149H246N44O42S
- Molecular Weight (Sermorelin): 3357.93 g/mol
- Sequence (Sermorelin): Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-NH2
- Molecular Formula (Ipamorelin): C38H49N9O5
- Molecular Weight (Ipamorelin): 711.85 g/mol
- Sequence (Ipamorelin): Aib-His-D-2-Nal-D-Phe-Lys-NH2
- Synonyms: Sermorelin (GHRH 1-29, Mod GRF), Ipamorelin (GHRP, Ghrelin mimetic)
Out of Stock