Home
Peptides by Form
Peptides by Form
Filters
Filters
Peptides by Form
Filter By Price
$
$
Brands
Substances
Manufacturers
Shipping Location
Default
Default
Price, low to high
Price, high to low
hGH Fragment 176-191 6 mg
- Active Substance: Growth Hormone Peptide Fragment 176-191
- Concentration: 6 mg per vial
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: Fragment HGH
- Molecular Formula: C78H125N20O23S
- Molecular Weight: ~1817 g/mol
- Sequence: Tyr-Leu-Arg-Ile-Val-Gln-Cys-Arg-Ser-Val-Glu-Gly-Ser-Cys-Gly-Phe
- Synonyms: hGH Fragment, AOD9604
Out of Stock
Humanin 10 mg
- Active Substance: Humanin
- Concentration: 10 mg per vial
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: Humanin
- Molecular Formula: C119H204N34O32S
- Molecular Weight: ~2687 g/mol
- Sequence: Met-Ala-Pro-Arg-Gly-Phe-Ser-Cys-Leu-Leu-Leu-Leu-Thr-Ser-Glu-Ile-Asp-Leu-Pro-Val-Lys-Arg-Arg-Ala
- Synonyms: Mitochondrial-Derived Peptide, HN
Out of Stock
IGF-1 DES 1 mg
- Active Substance: Insulin-Like Growth Factor 1, DES
- Concentration: 1 mg per vial
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: IGF-1 DES
- Molecular Formula: C319H501N91O96S7
- Molecular Weight: ~7377 g/mol
- Sequence: TLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
- Synonyms: DES(1-3)IGF-1, Truncated IGF-1
Out of Stock
IGF-1-LR3 1 mg
- Active Substance: Insulin-like Growth Factor 1, Long R3
- Concentration: 1 mg per vial
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: IGF-1 LR3
- Molecular Formula: C400H625N111O115S9
- Molecular Weight: 9117.5 g/mol
- Sequence: MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
- Synonyms: Long R3 IGF-1, LR3-IGF-1
Out of Stock
Ipamorelin 10 mg
- Active Substance: Ipamorelin
- Concentration: 10 mg per vial
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: Ipamorelin
- Molecular Formula: C38H49N9O5
- Molecular Weight: 711.85 g/mol
- Sequence: Aib-His-D-2-Nal-D-Phe-Lys-NH2
- Synonyms: Growth Hormone Secretagogue, GHRP
Out of Stock
Ipamorelin 5 mg
- Active Substance: Ipamorelin
- Concentration: 5 mg per vial
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: Ipamorelin
- Molecular Formula: C38H49N9O5
- Molecular Weight: 711.85 g/mol
- Sequence: Aib-His-D-2-Nal-D-Phe-Lys-NH2
- Synonyms: Growth Hormone Secretagogue, GHRP
Out of Stock
Ipamorelin 2 mg
- Active Substance: Ipamorelin
- Concentration: 2 mg per vial
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: Ipamorelin
- Molecular Formula: C38H49N9O5
- Molecular Weight: 711.85 g/mol
- Sequence: Aib-His-D-2-Nal-D-Phe-Lys-NH2
- Synonyms: Growth Hormone Secretagogue, GHRP
Out of Stock
Kisspeptin-10 5 mg
- Active Substance: Metastin (Kisspeptin-10)
- Concentration: 5 mg per vial
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: Kisspeptin
- Molecular Formula: C63H83N17O14
- Molecular Weight: 1302.4 g/mol
- Sequence: Tyr-Asn-Trp-Asn-Ser-Phe-Gly-Leu-Arg-Phe-NH2
- Synonyms: Kp-10, Kisspeptin, Metastin
Out of Stock
KPV 5 mg
- Active Substance: Lysine-Proline-Valine (KPV)
- Concentration: 5 mg per vial
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: KPV
- Molecular Formula: C16H30N4O4
- Molecular Weight: 342.43 g/mol
- Sequence: Lys-Pro-Val
- Synonyms: α-MSH(11-13), Melanocortin Tripeptide
Out of Stock
L-Glutathione 600 mg
- Active Substance: Glutathione (L-Glutathione)
- Concentration: 600 mg per vial
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: Glutathione
- Molecular Formula: C10H17N3O6S
- Molecular Weight: 307.32 g/mol
- Sequence: γ-L-Glu-L-Cys-Gly
- Synonyms: GSH, Reduced Glutathione
Out of Stock
Lipopeptide 200 mg
- Active Substance: Lipopeptide (Pal-Gly-Gln-Pro-Arg)
- Concentration: 200 mg
- Pack Size: Topical formulation (cream or serum)
- Manufacturer: Peptide Sciences USA
- Brand Name: Lipopeptide
- Molecular Formula: C38H68N6O8
- Molecular Weight: 736.98 g/mol
- Sequence: Pal-Gly-Gln-Pro-Arg
- Synonyms: Pal-GQPR, Palmitoyl Tetrapeptide-7/3, Biopeptide EL
Out of Stock
Livagen 20 mg
- Active Substance: Livagen (Lys-Glu-Asp-Ala)
- Concentration: 20 mg per vial
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: Livagen
- Molecular Formula: C18H31N5O9
- Molecular Weight: 461.5 g/mol
- Sequence: Lys-Glu-Asp-Ala
- Synonyms: KEDA, Bioregulatory Tetrapeptide
Out of Stock
Longevity - Performance & Obesity Research
- Active Substances: 5-amino-1MQ (50 mg/capsule), NMN (50 mg/capsule), JBSNF-000088 (5 mg/capsule)
- Concentration: 105 mg per capsule
- Pack Size: 60 capsules
- Manufacturer: Peptide Sciences USA
- Brand Name: Peptide Blend
- Molecular Formulas: 5-amino-1MQ (C10H11N2), NMN (C11H15N2O8P), JBSNF-000088 (C7H8N2O)
- Molecular Weights: 5-amino-1MQ (159.21 g/mol), NMN (334.22 g/mol), JBSNF-000088 (136.15 g/mol)
- Synonyms: 5-amino-1-methylquinolinium, Nicotinamide Mononucleotide, 6-Methoxynicotinamide
Out of Stock
Matrixyl 200 mg
- Product Title: Matrixyl 200 mg
- Active Substance: Matrixyl (Palmitoyl Pentapeptide-4)
- Concentration: 200 mg
- Pack Size: Topical formulation (cream or serum)
- Manufacturer: Peptide Sciences USA
- Brand Name: Matrixyl
- Molecular Formula: C39H75N7O10
- Molecular Weight: 802.05 g/mol
- Sequence: Pal-Lys-Thr-Thr-Lys-Ser-OH
- Synonyms: Pal-KTTKS, Palmitoyl Pentapeptide-3, Micro-collagen
Out of Stock
Melanostatin DM 200 mg
- Active Substance: Melanostatin DM (His-D-Arg-Ala-Trp-D-Phe-Lys)
- Concentration: 200 mg
- Pack Size: Topical formulation
- Manufacturer: Peptide Sciences USA
- Brand Name: Melanostatin DM
- Molecular Formula: C41H58N14O6
- Molecular Weight: 842.0 g/mol
- Sequence: His-D-Arg-Ala-Trp-D-Phe-Lys
- Synonyms: Melanostatine-5, Melanocyte-Inhibiting Peptide
Out of Stock
Melanotan 1 (MT1) 10 mg
- Active Substance: Melanotan 1 (Afamelanotide)
- Concentration: 10 mg per vial
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: Melanotan
- Molecular Formula: C78H111N21O19
- Molecular Weight: 1646.87 g/mol
- Sequence: Ser-Tyr-Ser-Nle-Glu-His-D-Phe-Arg-Trp-Gly-Lys-Pro-Val
- Synonyms: Afamelanotide, Scenesse, [Nle4-D-Phe7]-α-MSH
Out of Stock
MK-677 (Ibutamoren) 12.5 mg
- Active Substance: Ibutamoren (MK-677)
- Concentration: 12.5 mg per capsule
- Pack Size: 60 capsules
- Manufacturer: Peptide Sciences USA
- Brand Name: Ibutamoren
- Molecular Formula: C27H36N4O5S
- Molecular Weight: 528.7 g/mol
- Synonyms: MK-0677, Oratrope, L-163,191
Out of Stock
MOTS-c 10 mg
- Active Substance: MOTS-c (Mitochondrial-Derived Peptide)
- Concentration: 10 mg per vial
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: MOTS-c
- Molecular Formula: C74H115N23O23S2
- Molecular Weight: 1718.97 g/mol
- Sequence: Met-Arg-Trp-Gln-Glu-Met-Gly-Tyr-Ile-Phe-Tyr-Pro-Arg-Lys-Leu-Arg
- Synonyms: Mitochondrial ORF of the 12S rRNA-c, MDP
Out of Stock
MOTS-c 5 mg
- Active Substance: MOTS-c (Mitochondrial-Derived Peptide)
- Concentration: 5 mg per vial
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: MOTS-c
- Molecular Formula: C74H115N23O23S2
- Molecular Weight: 1718.97 g/mol
- Sequence: Met-Arg-Trp-Gln-Glu-Met-Gly-Tyr-Ile-Phe-Tyr-Pro-Arg-Lys-Leu-Arg
- Synonyms: Mitochondrial ORF of the 12S rRNA-c, MDP
Out of Stock
N-Acetyl Epithalon Amidate 20 mg
- Active Substance: Acetyl-Epitalon-Amidate
- Concentration: 20 mg per vial
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: Epitalon
- Molecular Formula: C14H22N4O9
- Molecular Weight: 446.45 g/mol
- Sequence: Ac-Ala-Glu-Asp-Gly-NH2
- Synonyms: N-Acetyl Epitalon, Epithalamin derivative, AEDG peptide
Out of Stock