Muscle Growth Peptides
Filters
Filters
Peptides By Research Purpose
Filter By Price
$
$
Brands
Substances
Manufacturers
Shipping Location
Default
Default
Price, low to high
Price, high to low
Hexarelin 2 mg
- Active Substance: Hexarelin
- Concentration: 2 mg per vial
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: Hexarelin
- Molecular Formula: C47H58N12O6
- Molecular Weight: 887.04 g/mol
- Sequence: His-D-2-Me-Trp-Ala-Trp-D-Phe-Lys-NH2
- Synonyms: Growth Hormone Secretagogue, Examorelin
Out of Stock
Hexarelin 5 mg
- Active Substance: Hexarelin
- Concentration: 5 mg per vial
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: Hexarelin
- Molecular Formula: C47H58N12O6
- Molecular Weight: 887.04 g/mol
- Sequence: His-D-2-Me-Trp-Ala-Trp-D-Phe-Lys-NH2
- Synonyms: Growth Hormone Secretagogue, Examorelin
Out of Stock
IGF-1 DES 1 mg
- Active Substance: Insulin-Like Growth Factor 1, DES
- Concentration: 1 mg per vial
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: IGF-1 DES
- Molecular Formula: C319H501N91O96S7
- Molecular Weight: ~7377 g/mol
- Sequence: TLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
- Synonyms: DES(1-3)IGF-1, Truncated IGF-1
Out of Stock
IGF-1-LR3 1 mg
- Active Substance: Insulin-like Growth Factor 1, Long R3
- Concentration: 1 mg per vial
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: IGF-1 LR3
- Molecular Formula: C400H625N111O115S9
- Molecular Weight: 9117.5 g/mol
- Sequence: MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
- Synonyms: Long R3 IGF-1, LR3-IGF-1
Out of Stock
Ipamorelin 5 mg
- Active Substance: Ipamorelin
- Concentration: 5 mg per vial
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: Ipamorelin
- Molecular Formula: C38H49N9O5
- Molecular Weight: 711.85 g/mol
- Sequence: Aib-His-D-2-Nal-D-Phe-Lys-NH2
- Synonyms: Growth Hormone Secretagogue, GHRP
Out of Stock
Ipamorelin 2 mg
- Active Substance: Ipamorelin
- Concentration: 2 mg per vial
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: Ipamorelin
- Molecular Formula: C38H49N9O5
- Molecular Weight: 711.85 g/mol
- Sequence: Aib-His-D-2-Nal-D-Phe-Lys-NH2
- Synonyms: Growth Hormone Secretagogue, GHRP
Out of Stock
Kisspeptin-10 5 mg
- Active Substance: Metastin (Kisspeptin-10)
- Concentration: 5 mg per vial
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: Kisspeptin
- Molecular Formula: C63H83N17O14
- Molecular Weight: 1302.4 g/mol
- Sequence: Tyr-Asn-Trp-Asn-Ser-Phe-Gly-Leu-Arg-Phe-NH2
- Synonyms: Kp-10, Kisspeptin, Metastin
Out of Stock
MK-677 (Ibutamoren) 12.5 mg
- Active Substance: Ibutamoren (MK-677)
- Concentration: 12.5 mg per capsule
- Pack Size: 60 capsules
- Manufacturer: Peptide Sciences USA
- Brand Name: Ibutamoren
- Molecular Formula: C27H36N4O5S
- Molecular Weight: 528.7 g/mol
- Synonyms: MK-0677, Oratrope, L-163,191
Out of Stock
PEG MGF 5 mg
- Active Substance: Pegylated Mechano Growth Factor (PEG MGF)
- Concentration: 5 mg per vial
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: PEG MGF
- Molecular Formula: C121H200N42O39
- Molecular Weight: ~2971.99 g/mol
- Sequence: PEG-Suc-Tyr-Gln-Pro-Pro-Ser-Thr-Asn-Lys-Asn-Thr-Lys-Ser-Gln-Arg-Arg-Lys-Gly-Ser-Thr-Phe-Glu-Glu-Arg-Lys-Cys
- Synonyms: Pegylated MGF, PEG IGF-1Ec, PEG Myotrophin
Out of Stock
Sermorelin / GHRP-6 / GHRP-2 9 mg
- Active Substances: Sermorelin, GHRP-6, GHRP-2
- Concentration: 9 mg per vial (3 mg each peptide)
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: Peptide Blend
- Synonyms: Sermorelin Acetate, GHRP-6 Acetate, GHRP-2 Acetate, Growth Hormone Peptide Blend
Out of Stock
Sermorelin 10 mg
- Active Substance: Sermorelin (GHRH Analog)
- Concentration: 10 mg per vial
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: Sermorelin
- Molecular Formula: C149H246N44O42S
- Molecular Weight: 3357.88 g/mol
- Sequence: Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-NH2
- Synonyms: Sermorelin Acetate, GHRH (1-29)
Out of Stock
Sermorelin 2 mg
- Active Substance: Sermorelin (GHRH Analog)
- Concentration: 2 mg per vial
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: Sermorelin
- Molecular Formula: C149H246N44O42S
- Molecular Weight: 3357.88 g/mol
- Sequence: Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-NH2
- Synonyms: Sermorelin Acetate, GHRH (1-29)
Out of Stock
SLU-PP-332
- Active Substance: SLU-PP-332 (Pan-ERR Agonist)
- Concentration: 1000 mcg per capsule
- Pack Size: 30 capsules (30,000 mcg total)
- Manufacturer: Peptide Sciences USA
- Brand Name: SLU-PP-332
- Molecular Formula: Not fully disclosed (medium-length peptide)
- Molecular Weight: 290.32 g/mol
- Sequence: Proprietary (10–30 amino acids)
- Synonyms: SLU-PP-332, ERR Agonist, Exercise Mimetic
Out of Stock
TB-500 2 mg
- Active Substance: Thymosin Beta-4 (TB-500)
- Concentration: 2 mg per vial
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: TB-500
- Categories: Injectable Peptides, Healing & Recovery Peptides, Muscle Growth Peptides, Immune & Longevity Support Peptides
- Molecular Formula: C212H350N56O78S
- Molecular Weight: 4963.49 g/mol
- Sequence: SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
- Synonyms: Thymosin Beta-4, TB500
Out of Stock
TB-500 5 mg
- Active Substance: Thymosin Beta-4 (TB-500)
- Concentration: 5 mg per vial
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: TB-500
- Molecular Formula: C212H350N56O78S
- Molecular Weight: 4963.49 g/mol
- Synonyms: Thymosin Beta-4, TB500
Out of Stock
Tesamorelin 5 mg
- Active Substance: Tesamorelin (GHRH Analog)
- Concentration: 5 mg per vial
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: Tesamorelin
- Molecular Formula: C221H366N72O67S
- Molecular Weight: 5135.9 g/mol
- Sequence: 44 amino acids (proprietary GHRH analog)
- Synonyms: Tesamorelin Acetate, Egrifta, TH9507
Out of Stock
Testagen 20 mg
- Active Substance: Testagen (Bioregulatory Tetrapeptide)
- Concentration: 20 mg per vial
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: Testagen
- Molecular Formula: C17H29N5O9
- Molecular Weight: 447.2 g/mol
- Sequence: Lys-Glu-Asp-Gly
- Synonyms: Testagen, KEDG, Anterior Pituitary Peptide (APP)
Out of Stock
Sermorelin 5 mg
- Active Substance: Sermorelin
- Concentration: 5 mg per vial
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: Sermorelin
- Molecular Formula: C149H246N44O42S
- Molecular Weight: 3357.96 g/mol
- Synonyms: GHRH 1–29, Sermorelin Acetate, Growth Hormone-Releasing Factor analog
Out of Stock
CJC-1295 / GHRP-2 10 mg
- Active Substance: Thyrotropin Releasing Hormone
- Concentration: 50 mg per vial
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: Protirelin
- Molecular Formula: C16H22N6O4
- Molecular Weight: 362.38 g/mol
- Sequence: pGlu-His-Pro-NH2
- Synonyms: Protirelin, TRH, Thyroliberin
Out of Stock
HCG 2500IU
- Active Substance: Human Chorionic Gonadotropin (HCG)
- Concentration: 2500 IU
- Pack Size: Full kit (1 vial + diluent)
- Manufacturer: Dragon Pharma
- Brand Name: Pregnyl
- Molecular Formula: C1107H1770N318O336S26
- Molecular Weight: ~36.7 kDa
- Synonyms: hCG, Chorionic Gonadotropin, Human LH Mimetic
Out of Stock
Out Of Stock
Out Of Stock
Out Of Stock
Out Of Stock
Out Of Stock
Out Of Stock
Out Of Stock
Out Of Stock
Out Of Stock
Out Of Stock
Out Of Stock
Out Of Stock
Out Of Stock
Out Of Stock
Out Of Stock
Out Of Stock
Out Of Stock
Out Of Stock
Out Of Stock
Out Of Stock