Peptide Sciences
Filters
Filters
Peptides by Brands
Brands
Substances
Shipping Location
Default
Default
Price, low to high
Price, high to low
NAD+ 100 mg
- Active Substance: Nicotinamide Adenine Dinucleotide (NAD+)
- Concentration: 100 mg per vial
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: NAD
- Molecular Formula: C21H27N7O14P2
- Molecular Weight: 663.43 g/mol
- Sequence: N/A (coenzyme)
- Synonyms: Nicotinamide Adenine Dinucleotide, beta-NAD, Endopride
Out of Stock
NAD+ 750 mg
- Active Substance: Nicotinamide Adenine Dinucleotide (NAD+)
- Concentration: 750 mg per vial
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: NAD
- Molecular Formula: C21H27N7O14P2
- Molecular Weight: 663.43 g/mol
- Synonyms: Nicotinamide Adenine Dinucleotide, beta-NAD, Endopride
Out of Stock
Nonapeptide-1 200 mg
- Concentration: 200 mg
- Pack Size: Topical
- Manufacturer: Peptide Sciences USA
- Brand Name: Nonapeptide
- Synonyms: Melanostatine-5, Tyr-Arg-Ser-Aar-Ala-Ala-Trp-Leu-Phe
- Molecular Formula: C63H90N16O13
- Molecular Weight: 1227.47 g/mol
- Peptide Sequence: Tyr-Arg-Ser-Aar-Ala-Ala-Trp-Leu-Phe
Out of Stock
Ovagen 20 mg
- Active Substance: Ovagen (Glu-Asp-Leu Tripeptide)
- Concentration: 20 mg per vial
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: Ovagen
- Molecular Formula: C15H25N3O8
- Molecular Weight: 375.37 g/mol
- Sequence: Glu-Asp-Leu (EDL)
- Synonyms: EDL, Glutamyl-Aspartyl-Leucine, AC-3
Out of Stock
Oxytocin 10 mg (6000 IU)
- Active Substance: Oxytocin
- Concentration: 10 mg per vial (6000 IU)
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: Oxytocin
- Molecular Formula: C43H66N12O12S2
- Molecular Weight: 1007.19 g/mol
- Sequence: Cys-Tyr-Ile-Gln-Asn-Cys-Pro-Leu-Gly-NH2
- Synonyms: Love Hormone, Pitocin, Syntocinon
Out of Stock
P21 5 mg
- Active Substance: P021 (CNTF mimetic)
- Concentration: 5 mg per vial
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: P021
- Molecular Formula: C30H54N6O5
- Molecular Weight: 578.8 g/mol
- Sequence: Ac-DGGL(A)G-NH2
- Synonyms: P021, Peptide 6c derivative, CNTF mimetic
Out of Stock
Pal-AHK 200 mg
- Active Substance: Palmitoyl Tripeptide-3 (Pal-GHK)
- Concentration: 200 mg per container
- Pack Size: Topical (cream, gel, or serum)
- Manufacturer: Peptide Sciences USA
- Brand Name: Palmitoyl Tripeptide-3
- Molecular Formula: C30H54N6O5
- Molecular Weight: 578.8 g/mol
- Sequence: Pal-Gly-His-Lys
- Synonyms: Pal-GHK, Palmitoyl Oligopeptide, Matrixyl component
Out of Stock
Pal-GHK 200 mg
- Active Substance: Palmitoyl Tripeptide-1 (Pal-GHK)
- Concentration: 200 mg per container
- Pack Size: Topical
- Manufacturer: Peptide Sciences USA
- Brand Name: Palmitoyl Oligopeptide
- Molecular Formula: C30H54N6O5
- Molecular Weight: 578.8 g/mol
- Sequence: Pal-Gly-His-Lys
- Synonyms: Palmitoyl Tripeptide-1, Pal-GHK, Matrixyl component
Out of Stock
Palmitoyl Dipeptide-6 200 mg
- Active Substance: Palmitoyl Dipeptide-6
- Concentration: 200 mg per container
- Pack Size: Topical
- Manufacturer: Peptide Sciences USA
- Brand Name: Palmitoyl Dipeptide-6
- Molecular Formula: C26H49N5O5 (estimated)
- Molecular Weight: 511.7 g/mol
- Sequence: Pal-Gly-Gln
- Synonyms: Palmitoyl Dipeptide-6, Pal-GQ
Out of Stock
PE-22-28
- Active Substance: PE-22-28 (Spadin Derivative)
- Concentration: 8 mg per vial
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: PE-22-28
- Molecular Formula: C35H55N11O9
- Molecular Weight: ~797.9 g/mol (estimated)
- Sequence: Gly-Val-Ser-Trp-Gly-Leu-Arg-OH
- Synonyms: Spadin Analog, TREK-1 Inhibitor
Out of Stock
PEG MGF 5 mg
- Active Substance: Pegylated Mechano Growth Factor (PEG MGF)
- Concentration: 5 mg per vial
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: PEG MGF
- Molecular Formula: C121H200N42O39
- Molecular Weight: ~2971.99 g/mol
- Sequence: PEG-Suc-Tyr-Gln-Pro-Pro-Ser-Thr-Asn-Lys-Asn-Thr-Lys-Ser-Gln-Arg-Arg-Lys-Gly-Ser-Thr-Phe-Glu-Glu-Arg-Lys-Cys
- Synonyms: Pegylated MGF, PEG IGF-1Ec, PEG Myotrophin
Out of Stock
Pentapeptide-18 200 mg
- Active Substance: Pentapeptide-18 (Leuphasyl)
- Concentration: 200 mg per container
- Pack Size: Topical
- Manufacturer: Peptide Sciences USA
- Brand Name: Leuphasyl
- Molecular Formula: C29H39N5O7
- Molecular Weight: 569.65 g/mol
- Sequence: Tyr-D-Ala-Gly-Phe-Leu
- Synonyms: Leuphasyl, Pentapeptide Leucine
Out of Stock
Pinealon 20 mg
- Active Substance: Pinealon (Tripeptide Bioregulator)
- Concentration: 20 mg per vial
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: Pinealon
- Molecular Formula: C14H26N6O8
- Molecular Weight: 406.40 g/mol
- Sequence: Glu-Asp-Arg (EDR)
- Synonyms: EDR Peptide, Pinealon Tripeptide
Out of Stock
PNC-27 5 mg
- Active Substance: PNC-27 Anti-Cancer Peptide
- Concentration: 5 mg per vial
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: PNC-27
- Molecular Formula: C188H293N53O44S
- Molecular Weight: 4031.7 g/mol
- Sequence: PPLSQETFSDLWKLL-KKWKMRRNQFWVKVQRG
- Synonyms: PNC-27 Peptide, p53 12-26 Penetratin
Out of Stock
Prostamax 20 mg
- Active Substance: Prostamax (Khavinson Tetrapeptide)
- Concentration: 20 mg per vial
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: Khavinson
- Molecular Formula: C20H33N5O9
- Molecular Weight: 487.5 g/mol
- Sequence: Lys-Glu-Asp-Pro (KEDP)
- Synonyms: KEDP, Prostamax Bioregulator
Out of Stock
PT-141 10 mg
- Active Substance: Bremelanotide (PT-141)
- Concentration: 10 mg per vial
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: PT 141
- Molecular Formula: C50H68N14O10
- Molecular Weight: 1025.18 g/mol
- Sequence: Ac-Nle-cyclo[Asp-His-D-Phe-Arg-Trp-Lys]-OH
- Synonyms: PT-141, Vyleesi, Bremelanotide Acetate
Out of Stock
Repair and Recovery
- Active Substances: Thymosin Beta 4 Fragment (Ac-SDKP), Stable BPC-157 Arginate
- Concentration: 3 mg per capsule (250 mcg BPC-157 Arginate, 2.5 mg Ac-SDKP)
- Pack Size: 60 capsules
- Manufacturer: Peptide Sciences USA
- Brand Name: Peptide Blend
- Molecular Formula (BPC-157 Arginate): C62H98N16O22
- Molecular Weight (BPC-157 Arginate): 1419 g/mol
- Sequence (BPC-157 Arginate): Gly-Glu-Pro-Pro-Pro-Gly-Lys-Pro-Ala-Asp-Asp-Ala-Gly-Leu-Val
- Molecular Formula (Ac-SDKP): C20H33N5O9
- Molecular Weight (Ac-SDKP): 487.5 g/mol
- Sequence (Ac-SDKP): Ac-Ser-Asp-Lys-Pro
- Synonyms: BPC-157 Arginate, TB-4 Fragment, Ac-SDKP, Goralatide, Seraspenide
Out of Stock
Rigin 200 mg
- Active Substance: Palmitoyl Tetrapeptide-7 (Rigin™)
- Concentration: 200 mg per container
- Pack Size: Topical (powder for reconstitution)
- Manufacturer: Peptide Sciences USA
- Brand Name: Rigin
- Molecular Formula: C34H62N8O7
- Molecular Weight: 694.9 g/mol
- Sequence: Palmitoyl-Gly-Gln-Pro-Arg (Pal-GQPR)
- Synonyms: Rigin, Palmitoyl Tetrapeptide-3, Pal-GQPR
Out of Stock
Selank 30 mg
- Active Substance: Selank Anxiolytic Peptide
- Concentration: 30 mg per vial
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: Selank
- Molecular Formula: C33H57N11O9
- Molecular Weight: 751.9 g/mol
- Sequence: Thr-Lys-Pro-Arg-Pro-Gly-Pro (TKPRPGP)
- Synonyms: Selank, TP-7, Tuftsin Analog
Out of Stock
Selank 5 mg
Product Details
- Active Substance: Selank Anxiolytic Peptide
- Concentration: 5 mg per vial
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: Selank
- Molecular Formula: C33H57N11O9
- Molecular Weight: 751.9 g/mol
- Sequence: Thr-Lys-Pro-Arg-Pro-Gly-Pro (TKPRPGP)
- Synonyms: Selank, TP-7, Tuftsin Analog
Out of Stock
Out Of Stock
Out Of Stock
Out Of Stock
Out Of Stock
Out Of Stock
Out Of Stock
Out Of Stock
Out Of Stock
Out Of Stock
Out Of Stock
Out Of Stock
Out Of Stock
Out Of Stock
Out Of Stock
Out Of Stock
Out Of Stock
Out Of Stock
Out Of Stock
Out Of Stock
Out Of Stock