Peptide Sciences
Filters
Filters
Peptides by Brands
Brands
Substances
Shipping Location
Default
Default
Price, low to high
Price, high to low
Semax 30 mg
- Active Substance: Semax Heptapeptide
- Concentration: 30 mg per vial
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: Semax
- Molecular Formula: C37H51N9O10S
- Molecular Weight: 813.92 g/mol
- Sequence: Met-Glu-His-Phe-Pro-Gly-Pro (MEHFPGP)
- Synonyms: Semax, ACTH(4-10) Analog, Pro-Gly-Pro-ACTH
Out of Stock
Semax 2 mg
- Active Substance: Semax Heptapeptide
- Concentration: 30 mg per vial
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: Semax
- Molecular Formula: C37H51N9O10S
- Molecular Weight: 813.92 g/mol
- Sequence: Met-Glu-His-Phe-Pro-Gly-Pro (MEHFPGP)
- Synonyms: Semax, ACTH(4-10) Analog, Pro-Gly-Pro-ACTH
Out of Stock
Semax 5 mg
- Active Substance: Semax Heptapeptide
- Concentration: 5 mg per vial
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: Semax
- Molecular Formula: C37H51N9O10S
- Molecular Weight: 813.92 g/mol
- Sequence: Met-Glu-His-Phe-Pro-Gly-Pro (MEHFPGP)
- Synonyms: Semax, ACTH(4-10) Analog, Pro-Gly-Pro-ACTH
Out of Stock
Sermorelin / GHRP-6 / GHRP-2 9 mg
- Active Substances: Sermorelin, GHRP-6, GHRP-2
- Concentration: 9 mg per vial (3 mg each peptide)
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: Peptide Blend
- Synonyms: Sermorelin Acetate, GHRP-6 Acetate, GHRP-2 Acetate, Growth Hormone Peptide Blend
Out of Stock
Sermorelin 10 mg
- Active Substance: Sermorelin (GHRH Analog)
- Concentration: 10 mg per vial
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: Sermorelin
- Molecular Formula: C149H246N44O42S
- Molecular Weight: 3357.88 g/mol
- Sequence: Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-NH2
- Synonyms: Sermorelin Acetate, GHRH (1-29)
Out of Stock
Sermorelin 2 mg
- Active Substance: Sermorelin (GHRH Analog)
- Concentration: 2 mg per vial
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: Sermorelin
- Molecular Formula: C149H246N44O42S
- Molecular Weight: 3357.88 g/mol
- Sequence: Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-NH2
- Synonyms: Sermorelin Acetate, GHRH (1-29)
Out of Stock
SLU-PP-332
- Active Substance: SLU-PP-332 (Pan-ERR Agonist)
- Concentration: 1000 mcg per capsule
- Pack Size: 30 capsules (30,000 mcg total)
- Manufacturer: Peptide Sciences USA
- Brand Name: SLU-PP-332
- Molecular Formula: Not fully disclosed (medium-length peptide)
- Molecular Weight: 290.32 g/mol
- Sequence: Proprietary (10–30 amino acids)
- Synonyms: SLU-PP-332, ERR Agonist, Exercise Mimetic
Out of Stock
SNAP-8 200 mg
- Active Substance: Acetyl Octapeptide-3 (SNAP-8)
- Concentration: 200 mg per container
- Pack Size: Topical (lyophilized powder for reconstitution)
- Manufacturer: Peptide Sciences USA
- Brand Name: SNAP-8
- Molecular Formula: C41H70N16O16S
- Molecular Weight: 1075.16 g/mol
- Sequence: Ac-Glu-Glu-Met-Gln-Arg-Arg-Ala-Asp-NH2
- Synonyms: SNAP-8, Acetyl Glutamyl Heptapeptide-1, Acetyl Octapeptide-3
Out of Stock
SS-31 25 mg
- Active Substance: SS-31 Mitochondria-Targeting Peptide (Elamipretide)
- Concentration: 25 mg per vial
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: Elamipretide
- Molecular Formula: C32H49N9O5
- Molecular Weight: 639.8 g/mol
- Sequence: D-Arg-2,6-dimethylTyr-Lys-Phe-NH2
- Synonyms: Elamipretide, Bendavia, MTP-131
Out of Stock
Syn-AKE 200 mg
- Active Substance: Dipeptide Diaminobutyroyl Benzylamide Diacetate (Syn-AKE)
- Concentration: 200 mg per container
- Pack Size: Topical
- Manufacturer: Peptide Sciences USA
- Brand Name: Syn-AKE
- Molecular Formula: C23H37N5O7
- Molecular Weight: 495.57 g/mol
- Sequence: β-Ala-Pro-Dab-NHBn
- Synonyms: Syn-AKE, Tripeptide-3, Syn-AKE Acetate
Out of Stock
Syn-Coll 200 mg
- Active Substance: Palmitoyl Tripeptide-5 (Syn-Coll)
- Concentration: 200 mg per container
- Pack Size: Topical (lyophilized powder for reconstitution)
- Manufacturer: Peptide Sciences USA
- Brand Name: Syn-Coll
- Molecular Formula: C33H65N5O5
- Molecular Weight: 611.9 g/mol
- Sequence: Pal-Lys-Val-Lys
- Synonyms: Syn-Coll, Tripeptide-5, Palmitoyl-Lys-Val-Lys
Out of Stock
TB-500 10 mg
- Active Substance: Thymosin Beta-4 (TB-500)
- Concentration: 10 mg per vial
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: TB-500
- Molecular Formula: C38H65N11O14
- Molecular Weight: 889.0 g/mol
- Sequence: Ac-LKKTETQ
- Synonyms: TB-500, Thymosin Beta-4 Fragment, Fequesetide
Out of Stock
TB-500 2 mg
- Active Substance: Thymosin Beta-4 (TB-500)
- Concentration: 2 mg per vial
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: TB-500
- Categories: Injectable Peptides, Healing & Recovery Peptides, Muscle Growth Peptides, Immune & Longevity Support Peptides
- Molecular Formula: C212H350N56O78S
- Molecular Weight: 4963.49 g/mol
- Sequence: SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
- Synonyms: Thymosin Beta-4, TB500
Out of Stock
TB-500 5 mg
- Active Substance: Thymosin Beta-4 (TB-500)
- Concentration: 5 mg per vial
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: TB-500
- Molecular Formula: C212H350N56O78S
- Molecular Weight: 4963.49 g/mol
- Synonyms: Thymosin Beta-4, TB500
Out of Stock
TB-500 Fragment (17-23) 10 mg
- Active Substance: TB-500 Fragment (17-23) (Fequesetide)
- Concentration: 10 mg per vial
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: TB-500
- Molecular Formula: C38H65N11O14
- Molecular Weight: 889.0 g/mol
- Sequence: Ac-LKKTETQ
- Synonyms: TB-500 Fragment, Fequesetide, Thymosin Beta-4 (17-23)
Out of Stock
Tesamorelin / CJC1295 / Ipamorelin 12 mg
- Active Substances: Tesamorelin, CJC-1295 (Mod GRF 1-29, no DAC), Ipamorelin
- Concentration: 12 mg per vial (6 mg Tesamorelin, 3 mg CJC-1295, 3 mg Ipamorelin)
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: Peptide Blend
- Synonyms: Tesamorelin / CJC-1295 / Ipamorelin Blend, GHRH/GHRP Blend
Out of Stock
Tesamorelin 2 mg
- Active Substance: Tesamorelin
- Concentration: 2 mg per vial
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: Tesamorelin
- Molecular Formula: C221H366N72O67S
- Molecular Weight: 5135.89 g/mol
- Sequence: H-His-D-Trp-Ala-Trp-D-Phe-Lys-Thr-Phe-Thr-Ser-Tyr-Ser-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-Ser-Arg-NH2
- Synonyms: Egrifta, Growth Hormone-Releasing Factor (GHRF) Analog
Out of Stock
Tesamorelin 5 mg
- Active Substance: Tesamorelin (GHRH Analog)
- Concentration: 5 mg per vial
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: Tesamorelin
- Molecular Formula: C221H366N72O67S
- Molecular Weight: 5135.9 g/mol
- Sequence: 44 amino acids (proprietary GHRH analog)
- Synonyms: Tesamorelin Acetate, Egrifta, TH9507
Out of Stock
Tesofensine 500 mcg
- Active Substance: Tesofensine (Triple Monoamine Reuptake Inhibitor)
- Concentration: 500 mcg per capsule
- Pack Size: 30 capsules (15,000 mcg total)
- Manufacturer: Peptide Sciences USA
- Brand Name: Tesofensine
- Molecular Formula: C17H23Cl2NO
- Molecular Weight: 328.28 g/mol
- Sequence: Not a peptide (N-[3-(3,4-dichlorophenyl)-1-methylpropyl]-N-methylpropan-1-amine)
- Synonyms: NS2330, TE, Tesofensine Acetate
Out of Stock
Testagen 20 mg
- Active Substance: Testagen (Bioregulatory Tetrapeptide)
- Concentration: 20 mg per vial
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: Testagen
- Molecular Formula: C17H29N5O9
- Molecular Weight: 447.2 g/mol
- Sequence: Lys-Glu-Asp-Gly
- Synonyms: Testagen, KEDG, Anterior Pituitary Peptide (APP)
Out of Stock
Out Of Stock
Out Of Stock
Out Of Stock
Out Of Stock
Out Of Stock
Out Of Stock
Out Of Stock
Out Of Stock
Out Of Stock
Out Of Stock
Out Of Stock
Out Of Stock
Out Of Stock
Out Of Stock
Out Of Stock
Out Of Stock
Out Of Stock
Out Of Stock
Out Of Stock
Out Of Stock