Peptides by Brands

Showing 50 of 173 products
Image
SKU
Product
Rating
Price
Peptide Sciences USA
  • Product Title: CJC-1295 / Hexarelin 10 mg
  • Active Substance: Duo-Blend CJC-1295 No DAC and Hexarelin (5 mg each)
  • Concentration: 10 mg per vial (5 mg CJC-1295 No DAC + 5 mg Hexarelin)
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: Peptide Blend
  • Molecular Formula (CJC-1295 No DAC): C152H252N44O42
  • Molecular Weight (CJC-1295 No DAC): 3367.97 g/mol
  • Sequence (CJC-1295 No DAC): H-Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-Ser-Arg-NH2
  • Molecular Formula (Hexarelin): C47H58N12O6
  • Molecular Weight (Hexarelin): 887.04 g/mol
  • Sequence (Hexarelin): His-D-2-methyl-Trp-Ala-Trp-D-Phe-Lys-NH2
  • Synonyms: CJC-1295 No DAC (Modified GRF 1-29, Sermorelin analog), Hexarelin (Examorelin, Growth Hormone-Releasing Hexapeptide)
Peptide Sciences USA
  • Active Substance: CJC-1295 No DAC
  • Concentration: 2 mg per vial
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: Mod GRF (1-29)
  • Molecular Formula: C152H252N44O42
  • Molecular Weight: 3367.97 g/mol
  • Sequence: H-Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-Ser-Arg-NH2
  • Synonyms: Modified GRF (1-29), Sermorelin analog
Peptide Sciences USA
  • Active Substance: CJC-1295 DAC / Ipamorelin / GHRP-2 (3 mg each)
  • Concentration: 9 mg per vial (3 mg CJC-1295 DAC + 3 mg Ipamorelin + 3 mg GHRP-2)
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: Peptide Blend
  • Molecular Formula (CJC-1295 DAC): C152H252N44O42 (with DAC modification)
  • Molecular Weight (CJC-1295 DAC): ~3367.97 g/mol
  • Sequence (CJC-1295 DAC): H-Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-Ser-Arg-Lys(Maleimidopropionyl)-NH2
  • Molecular Formula (Ipamorelin): C38H49N9O5
  • Molecular Weight (Ipamorelin): 711.85 g/mol
  • Sequence (Ipamorelin): Aib-His-D-2-Nal-D-Phe-Lys-NH2
  • Molecular Formula (GHRP-2): C45H55N9O6
  • Molecular Weight (GHRP-2): 818.0 g/mol
  • Sequence (GHRP-2): D-Ala-D-2-Nal-Ala-Trp-D-Phe-Lys-NH2
  • Synonyms: CJC-1295 DAC (DAC:GRF), Ipamorelin (GHRP, Ghrelin mimetic), GHRP-2 (Pralmorelin)
Peptide Sciences USA
  • Active Substance: Cortagen
  • Concentration: 20 mg per vial
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: Cortagen
  • Molecular Formula: C17H27N5O8
  • Molecular Weight: 430.17 g/mol
  • Sequence: Ala-Glu-Asp-Pro
  • Synonyms: AEDP, SCHEMBL5491754
Peptide Sciences USA
  • Product Title: Decapeptide-12
  • Active Substance: Decapeptide-12
  • Concentration: 200 mg
  • Pack Size: Topical
  • Manufacturer: Peptide Sciences USA
  • Brand Name: Decapeptide
  • Molecular Formula: C65H90N18O17
  • Molecular Weight: 1311.46 g/mol
  • Sequence: Tyr-Arg-Ser-Arg-Lys-Tyr-Ser-Ser-Trp-Tyr
  • Synonyms: YRSRKYSSWY, Lumixyl
Peptide Sciences USA
  • Active Substance: Delta-sleep-inducing peptide
  • Concentration: 5 mg per vial
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: DSIP
  • Molecular Formula: C35H48N10O15
  • Molecular Weight: 848.81 g/mol
  • Sequence: Trp-Ala-Gly-Gly-Asp-Ala-Ser-Gly-Glu
  • Synonyms: Delta-sleep-inducing peptide, WAGGDASGE
Peptide Sciences USA
  • Active Substance: Modified GRF (CJC-1295 No DAC) and GHRP-2 (5 mg each)
  • Concentration: 10 mg per vial (5 mg Mod GRF + 5 mg GHRP-2)
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: Peptide Blend
  • Molecular Formula (Mod GRF): C152H252N44O42
  • Molecular Weight (Mod GRF): 3367.97 g/mol
  • Sequence (Mod GRF): H-Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-Ser-Arg-NH2
  • Molecular Formula (GHRP-2): C45H55N9O6
  • Molecular Weight (GHRP-2): 818.0 g/mol
  • Sequence (GHRP-2): D-Ala-D-2-Nal-Ala-Trp-D-Phe-Lys-NH2
  • Synonyms: Mod GRF (CJC-1295 No DAC, Sermorelin analog), GHRP-2 (Pralmorelin)
Peptide Sciences USA
  • Active Substance: Modified GRF (CJC-1295 No DAC) and GHRP-6 (5 mg each)
  • Concentration: 10 mg per vial (5 mg Mod GRF + 5 mg GHRP-6)
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: Peptide Blend
  • Molecular Formula (Mod GRF): C152H252N44O42
  • Molecular Weight (Mod GRF): 3367.97 g/mol
  • Sequence (Mod GRF): H-Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-Ser-Arg-NH2
  • Molecular Formula (GHRP-6): C46H56N12O6
  • Molecular Weight (GHRP-6): 873.01 g/mol
  • Sequence (GHRP-6): His-D-Trp-Ala-Trp-D-Phe-Lys-NH2
  • Synonyms: Mod GRF (CJC-1295 No DAC, Sermorelin analog), GHRP-6 (Growth Hormone-Releasing Hexapeptide)
Peptide Sciences USA
  • Active Substance: Modified GRF (CJC-1295 No DAC) and Hexarelin (5 mg each)
  • Concentration: 10 mg per vial (5 mg Mod GRF + 5 mg Hexarelin)
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: Peptide Blend
  • Molecular Formula (Mod GRF): C152H252N44O42
  • Molecular Weight (Mod GRF): 3367.97 g/mol
  • Sequence (Mod GRF): H-Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-Ser-Arg-NH2
  • Molecular Formula (Hexarelin): C47H58N12O6
  • Molecular Weight (Hexarelin): 887.04 g/mol
  • Sequence (Hexarelin): His-D-2-methyl-Trp-Ala-Trp-D-Phe-Lys-NH2
  • Synonyms: Mod GRF (CJC-1295 No DAC, Sermorelin analog), Hexarelin (Examorelin)
  • PubChem CID (Hexarelin): 5464109
Peptide Sciences USA
  • Active Substance: Modified GRF (CJC-1295 No DAC) and Ipamorelin (5 mg each)
  • Concentration: 10 mg per vial (5 mg Mod GRF + 5 mg Ipamorelin)
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: Peptide Blend
  • Molecular Formula (Mod GRF): C152H252N44O42
  • Molecular Weight (Mod GRF): 3367.97 g/mol
  • Sequence (Mod GRF): H-Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-Ser-Arg-NH2
  • Molecular Formula (Ipamorelin): C38H49N9O5
  • Molecular Weight (Ipamorelin): 711.85 g/mol
  • Sequence (Ipamorelin): Aib-His-D-2-Nal-D-Phe-Lys-NH2
  • Synonyms: Mod GRF (CJC-1295 No DAC, Sermorelin analog), Ipamorelin (GHRP, Ghrelin mimetic)
Peptide Sciences USA
  • Active Substance: Sermorelin (Mod GRF, GHRH 1-29) and GHRP-2 (5 mg each)
  • Concentration: 10 mg per vial (5 mg Sermorelin + 5 mg GHRP-2)
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: Peptide Blend
  • Molecular Formula (Sermorelin): C149H246N44O42S
  • Molecular Weight (Sermorelin): 3357.93 g/mol
  • Sequence (Sermorelin): Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-NH2
  • Molecular Formula (GHRP-2): C45H55N9O6
  • Molecular Weight (GHRP-2): 818.0 g/mol
  • Sequence (GHRP-2): D-Ala-D-2-Nal-Ala-Trp-D-Phe-Lys-NH2
  • Synonyms: Sermorelin (GHRH 1-29, Mod GRF), GHRP-2 (Pralmorelin)
Peptide Sciences USA
  • Active Substance: Sermorelin (GHRH 1-29) and GHRP-6 (5 mg each)
  • Concentration: 10 mg per vial (5 mg Sermorelin + 5 mg GHRP-6)
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: Peptide Blend
  • Molecular Formula (Sermorelin): C149H246N44O42S
  • Molecular Weight (Sermorelin): 3357.93 g/mol
  • Sequence (Sermorelin): Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-NH2
  • Molecular Formula (GHRP-6): C46H56N12O6
  • Molecular Weight (GHRP-6): 873.01 g/mol
  • Sequence (GHRP-6): His-D-Trp-Ala-Trp-D-Phe-Lys-NH2
  • Synonyms: Sermorelin (GHRH 1-29, Mod GRF), GHRP-6 (Growth Hormone-Releasing Hexapeptide)
Peptide Sciences USA
  • Active Substance: Sermorelin (GHRH 1-29) and Ipamorelin (5 mg each)
  • Concentration: 10 mg per vial (5 mg Sermorelin + 5 mg Ipamorelin)
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: Peptide Blend
  • Molecular Formula (Sermorelin): C149H246N44O42S
  • Molecular Weight (Sermorelin): 3357.93 g/mol
  • Sequence (Sermorelin): Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-NH2
  • Molecular Formula (Ipamorelin): C38H49N9O5
  • Molecular Weight (Ipamorelin): 711.85 g/mol
  • Sequence (Ipamorelin): Aib-His-D-2-Nal-D-Phe-Lys-NH2
  • Synonyms: Sermorelin (GHRH 1-29, Mod GRF), Ipamorelin (GHRP, Ghrelin mimetic)
Peptide Sciences USA
  • Active Substance: Tesamorelin (6 mg) and Ipamorelin (2 mg)
  • Concentration: 8 mg per vial (6 mg Tesamorelin + 2 mg Ipamorelin)
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: Peptide Blend
  • Molecular Formula (Tesamorelin): C221H366N72O67S
  • Molecular Weight (Tesamorelin): 5135.86 g/mol
  • Sequence (Tesamorelin): Unk-Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-Gln-Gln-Gly-Glu-Ser-Asn-Gln-Glu-Arg-Gly-Ala-Arg-Ala-Arg-Leu-NH2
  • Molecular Formula (Ipamorelin): C38H49N9O5
  • Molecular Weight (Ipamorelin): 711.85 g/mol
  • Sequence (Ipamorelin): Aib-His-D-2-Nal-D-Phe-Lys-NH2
  • Synonyms: Tesamorelin (Egrifta, TH9507), Ipamorelin (GHRP, Ghrelin mimetic)
Peptide Sciences USA
  • Active Substance: Epitalon
  • Concentration: 3 mg per capsule
  • Pack Size: 60 capsules
  • Manufacturer: Peptide Sciences USA
  • Brand Name: Epitalon
  • Molecular Formula: C14H22N4O9
  • Molecular Weight: 390.35 g/mol
  • Sequence: Ala-Glu-Asp-Gly
  • Synonyms: Epithalon, AEDG, Epithalamin analog
Peptide Sciences USA
  • Active Substance: Epitalon
  • Concentration: 50 mg per vial
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: Epitalon
  • Molecular Formula: C14H22N4O9
  • Molecular Weight: 390.35 g/mol
  • Sequence: Ala-Glu-Asp-Gly
  • Synonyms: Epithalon, AEDG, Epithalamin analog
Peptide Sciences USA
  • Active Substance: Proxofim (FOXO4-D-Retro-Inverso)
  • Concentration: 10 mg per vial
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: Proxofim
  • Molecular Formula: C228H388N86O64
  • Molecular Weight: 5358.05 g/mol
  • Sequence: H-D-Leu-D-Thr-D-Leu-D-Arg-D-Lys-D-Glu-D-Pro-D-Ala-D-Ser-D-Glu-D-Ile-D-Ala-D-Gln-D-Ser-D-Ile-D-Leu-D-Glu-D-Ala-D-Tyr-D-Ser-D-Gln-D-Asn-D-Gly-D-Trp-D-Ala-D-Asn-D-Arg-D-Arg-D-Ser-D-Gly-D-Gly-D-Lys-D-Arg-D-Pro-D-Pro-D-Pro-D-Arg-D-Arg-D-Arg-D-Gln-D-Arg-D-Arg-D-Lys-D-Lys-D-Arg-D-Gly-OH
  • Synonyms: Forkhead box protein O4 D-Retro-Inverso, FOXO4a, AFX, AFX1, MLLT7
Peptide Sciences USA
  • Active Substance: HGH Fragment 176-191 (6 mg), Modified GRF (CJC-1295 No DAC, 3 mg), Ipamorelin (3 mg)
  • Concentration: 12 mg per vial (6 mg HGH Fragment 176-191 + 3 mg Modified GRF + 3 mg Ipamorelin)
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: Peptide Blend
  • Molecular Formula (HGH Fragment 176-191): C78H125N24O24S2
  • Molecular Weight (HGH Fragment 176-191): 1817.12 g/mol
  • Sequence (HGH Fragment 176-191): Tyr-Leu-Arg-Ile-Val-Gln-Cys-Arg-Ser-Val-Glu-Gly-Ser-Cys-Gly-Phe
  • Molecular Formula (Modified GRF): C152H252N44O42
  • Molecular Weight (Modified GRF): 3367.97 g/mol
  • Sequence (Modified GRF): H-Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-Ser-Arg-NH2
  • Molecular Formula (Ipamorelin): C38H49N9O5
  • Molecular Weight (Ipamorelin): 711.85 g/mol
  • Sequence (Ipamorelin): Aib-His-D-2-Nal-D-Phe-Lys-NH2
  • Synonyms: HGH Fragment 176-191 (AOD9604), Modified GRF (CJC-1295 No DAC), Ipamorelin (GHRP, Ghrelin mimetic)
Peptide Sciences USA
  • Active Substance: HGH Fragment 176-191 (6 mg), CJC1295 No DAC (3 mg), Ipamorelin (3 mg)
  • Concentration: 12 mg per vial (6 mg HGH Fragment 176-191 + 3 mg CJC1295 + 3 mg Ipamorelin)
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: Peptide Blend
  • Molecular Formula (HGH Fragment 176-191): C78H125N24O24S2
  • Molecular Weight (HGH Fragment 176-191): 1817.12 g/mol
  • Sequence (HGH Fragment 176-191): Tyr-Leu-Arg-Ile-Val-Gln-Cys-Arg-Ser-Val-Glu-Gly-Ser-Cys-Gly-Phe
  • Molecular Formula (CJC1295 No DAC): C152H252N44O42
  • Molecular Weight (CJC1295 No DAC): 3367.97 g/mol
  • Sequence (CJC1295 No DAC): H-Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-Ser-Arg-NH2
  • Molecular Formula (Ipamorelin): C38H49N9O5
  • Molecular Weight (Ipamorelin): 711.85 g/mol
  • Sequence (Ipamorelin): Aib-His-D-2-Nal-D-Phe-Lys-NH2
  • Synonyms: HGH Fragment 176-191 (AOD9604), CJC1295 No DAC (Mod GRF), Ipamorelin (GHRP, Ghrelin mimetic)
Peptide Sciences USA
  • Active Substance: Tripeptide-1 (Glycyl-L-Histidyl-L-Lysine)
  • Concentration: 200 mg per vial
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: GHK Basic
  • Molecular Formula: C14H24N6O4
  • Molecular Weight: 340.38 g/mol
  • Sequence: Gly-His-Lys
  • Synonyms: GHK, Glycyl-L-Histidyl-L-Lysine, Tripeptide-1
Peptide Sciences USA
  • Active Substance: Tripeptide-1 (Glycyl-L-Histidyl-L-Lysine)
  • Concentration: 50 mg per vial
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: GHK Basic
  • Molecular Formula: C14H24N6O4
  • Molecular Weight: 340.38 g/mol
  • Sequence: Gly-His-Lys
  • Synonyms: GHK, Glycyl-L-Histidyl-L-Lysine, Tripeptide-1
Peptide Sciences USA
  • Active Substance: Glycyl-L-Histidyl-L-Lysine Copper Complex (GHK-Cu)
  • Concentration: 1000 mg per container
  • Pack Size: Topical formulation
  • Manufacturer: Peptide Sciences USA
  • Brand Name: GHK-Cu
  • Molecular Formula: C14H22N6O4Cu
  • Molecular Weight: ~403 g/mol
  • Sequence: Gly-His-Lys-Cu
  • Synonyms: Copper Tripeptide-1, GHK Copper Peptide
Peptide Sciences USA
  • Active Substance: Glycyl-L-Histidyl-L-Lysine Copper Complex (GHK-Cu)
  • Concentration: 2 mg per capsule
  • Pack Size: 60 capsules
  • Manufacturer: Peptide Sciences USA
  • Brand Name: GHK-Cu
  • Categories: Oral Peptides, Immune & Longevity Support Peptides, Anti-Aging & Skin Health Peptides
  • Molecular Formula: C14H22N6O4Cu
  • Molecular Weight: ~403 g/mol
  • Sequence: Gly-His-Lys-Cu
  • Synonyms: Copper Tripeptide-1, GHK Copper Peptide
Peptide Sciences USA
  • Active Substance: Glycyl-L-Histidyl-L-Lysine Copper Complex (GHK-Cu)
  • Concentration: 200 mg per container
  • Pack Size: Single container (lyophilized powder for topical formulation)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: GHK-Cu
  • Molecular Formula: C14H22N6O4Cu
  • Molecular Weight: ~403 g/mol
  • Sequence: Gly-His-Lys-Cu
  • Synonyms: Copper Tripeptide-1, GHK Copper Peptide
Peptide Sciences USA
  • Active Substance: Glycyl-L-Histidyl-L-Lysine Copper Complex (GHK-Cu)
  • Concentration: 50 mg per vial
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: GHK-Cu
  • Molecular Formula: C14H22N6O4Cu
  • Molecular Weight: ~403 g/mol
  • Sequence: Gly-His-Lys-Cu
  • Synonyms: Copper Tripeptide-1, GHK Copper Peptide
Peptide Sciences USA
  • Active Substance: Glycyl-L-Histidyl-L-Lysine Copper Complex (GHK-Cu)
  • Concentration: 500 mg per container
  • Pack Size: Single container (lyophilized powder for topical formulation)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: GHK-Cu
  • Molecular Formula: C14H22N6O4Cu
  • Molecular Weight: ~403 g/mol
  • Sequence: Gly-His-Lys-Cu
  • Synonyms: Copper Tripeptide-1, GHK Copper Peptide
Peptide Sciences USA
  • Active Substance: Growth Hormone–Releasing Hormone (Sermorelin analog)
  • Concentration: 5 mg per vial
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: Somatoliberin
  • Molecular Formula: C149H246N44O42S
  • Molecular Weight: 3357.93 g/mol
  • Sequence: Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-NH2
  • Synonyms: Somatoliberin, Sermorelin, GHRH 1-29
Peptide Sciences USA
  • Active Substance: Growth Hormone-Releasing Peptide 2 (GHRP-2)
  • Concentration: 10 mg per vial
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: GHRP-2
  • Molecular Formula: C45H55N9O6
  • Molecular Weight: 818.0 g/mol
  • Sequence: D-Ala-D-2-Nal-Ala-Trp-D-Phe-Lys-NH2
  • Synonyms: Pralmorelin, Growth Hormone Secretagogue
Peptide Sciences USA
  • Active Substance: Growth Hormone-Releasing Peptide 2 (GHRP-2)
  • Concentration: 5 mg per vial
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: GHRP-2
  • Molecular Formula: C45H55N9O6
  • Molecular Weight: 818.0 g/mol
  • Sequence: D-Ala-D-2-Nal-Ala-Trp-D-Phe-Lys-NH2
  • Synonyms: Pralmorelin, Growth Hormone Secretagogue
Peptide Sciences USA
  • Active Substance: Growth Hormone-Releasing Peptide 6 (GHRP-6)
  • Concentration: 10 mg per vial
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: GHRP-6
  • Molecular Formula: C46H56N12O6
  • Molecular Weight: 873.01 g/mol
  • Sequence: His-D-Trp-Ala-Trp-D-Phe-Lys-NH2
  • Synonyms: Growth Hormone Secretagogue, GHRP-6
Peptide Sciences USA
  • Active Substance: Growth Hormone-Releasing Peptide 6 (GHRP-6)
  • Concentration: 5 mg per vial
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: GHRP-6
  • Molecular Formula: C46H56N12O6
  • Molecular Weight: 873.01 g/mol
  • Sequence: His-D-Trp-Ala-Trp-D-Phe-Lys-NH2
  • Synonyms: Growth Hormone Secretagogue, GHRP-6
Peptide Sciences USA
  • Active Substance: Gonadotropin-Releasing Hormone (Gonadorelin)
  • Concentration: 10 mg per vial
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: Gonadorelin
  • Molecular Formula: C55H75N17O13
  • Molecular Weight: 1182.29 g/mol
  • Sequence: pGlu-His-Trp-Ser-Tyr-Gly-Leu-Arg-Pro-Gly-NH2
  • Synonyms: GnRH, LHRH, Gonadotropin-Releasing Hormone
Peptide Sciences USA
  • Active Substances: Stable BPC-157 (Arginate Salt, 500 mcg), KPV (500 mcg), PEA (400 mg), Tributyrin (400 mg)
  • Concentration: 801 mg per capsule
  • Pack Size: 60 capsules
  • Manufacturer: Peptide Sciences USA
  • Brand Name: Peptide Blend
  • Molecular Formulas: BPC-157 (C62H98N16O22), KPV (C16H30N4O4), PEA (C18H37NO2), Tributyrin (C15H26O6)
  • Molecular Weights: BPC-157 (~1419 g/mol), KPV (342.43 g/mol), PEA (299.49 g/mol), Tributyrin (302.36 g/mol)
Peptide Sciences USA
  • Active Substance: Hexarelin
  • Concentration: 2 mg per vial
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: Hexarelin
  • Molecular Formula: C47H58N12O6
  • Molecular Weight: 887.04 g/mol
  • Sequence: His-D-2-Me-Trp-Ala-Trp-D-Phe-Lys-NH2
  • Synonyms: Growth Hormone Secretagogue, Examorelin
Peptide Sciences USA
  • Active Substance: Hexarelin
  • Concentration: 5 mg per vial
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: Hexarelin
  • Molecular Formula: C47H58N12O6
  • Molecular Weight: 887.04 g/mol
  • Sequence: His-D-2-Me-Trp-Ala-Trp-D-Phe-Lys-NH2
  • Synonyms: Growth Hormone Secretagogue, Examorelin
Peptide Sciences USA
  • Active Substance: Growth Hormone Peptide Fragment 176-191
  • Concentration: 6 mg per vial
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: Fragment HGH
  • Molecular Formula: C78H125N20O23S
  • Molecular Weight: ~1817 g/mol
  • Sequence: Tyr-Leu-Arg-Ile-Val-Gln-Cys-Arg-Ser-Val-Glu-Gly-Ser-Cys-Gly-Phe
  • Synonyms: hGH Fragment, AOD9604
Peptide Sciences USA
  • Active Substance: Humanin
  • Concentration: 10 mg per vial
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: Humanin
  • Molecular Formula: C119H204N34O32S
  • Molecular Weight: ~2687 g/mol
  • Sequence: Met-Ala-Pro-Arg-Gly-Phe-Ser-Cys-Leu-Leu-Leu-Leu-Thr-Ser-Glu-Ile-Asp-Leu-Pro-Val-Lys-Arg-Arg-Ala
  • Synonyms: Mitochondrial-Derived Peptide, HN
Peptide Sciences USA
  • Active Substance: Insulin-Like Growth Factor 1, DES
  • Concentration: 1 mg per vial
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: IGF-1 DES
  • Molecular Formula: C319H501N91O96S7
  • Molecular Weight: ~7377 g/mol
  • Sequence: TLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
  • Synonyms: DES(1-3)IGF-1, Truncated IGF-1
Peptide Sciences USA
  • Active Substance: Insulin-like Growth Factor 1, Long R3
  • Concentration: 1 mg per vial
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: IGF-1 LR3
  • Molecular Formula: C400H625N111O115S9
  • Molecular Weight: 9117.5 g/mol
  • Sequence: MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
  • Synonyms: Long R3 IGF-1, LR3-IGF-1
Peptide Sciences USA
  • Active Substance: Ipamorelin
  • Concentration: 10 mg per vial
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: Ipamorelin
  • Molecular Formula: C38H49N9O5
  • Molecular Weight: 711.85 g/mol
  • Sequence: Aib-His-D-2-Nal-D-Phe-Lys-NH2
  • Synonyms: Growth Hormone Secretagogue, GHRP
Peptide Sciences USA
  • Active Substance: Ipamorelin
  • Concentration: 5 mg per vial
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: Ipamorelin
  • Molecular Formula: C38H49N9O5
  • Molecular Weight: 711.85 g/mol
  • Sequence: Aib-His-D-2-Nal-D-Phe-Lys-NH2
  • Synonyms: Growth Hormone Secretagogue, GHRP
Peptide Sciences USA
  • Active Substance: Ipamorelin
  • Concentration: 2 mg per vial
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: Ipamorelin
  • Molecular Formula: C38H49N9O5
  • Molecular Weight: 711.85 g/mol
  • Sequence: Aib-His-D-2-Nal-D-Phe-Lys-NH2
  • Synonyms: Growth Hormone Secretagogue, GHRP
Peptide Sciences USA
  • Active Substance: Metastin (Kisspeptin-10)
  • Concentration: 5 mg per vial
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: Kisspeptin
  • Molecular Formula: C63H83N17O14
  • Molecular Weight: 1302.4 g/mol
  • Sequence: Tyr-Asn-Trp-Asn-Ser-Phe-Gly-Leu-Arg-Phe-NH2
  • Synonyms: Kp-10, Kisspeptin, Metastin
Peptide Sciences USA
  • Active Substance: Lysine-Proline-Valine (KPV)
  • Concentration: 5 mg per vial
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: KPV
  • Molecular Formula: C16H30N4O4
  • Molecular Weight: 342.43 g/mol
  • Sequence: Lys-Pro-Val
  • Synonyms: α-MSH(11-13), Melanocortin Tripeptide
Peptide Sciences USA
  • Active Substance: Glutathione (L-Glutathione)
  • Concentration: 600 mg per vial
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: Glutathione
  • Molecular Formula: C10H17N3O6S
  • Molecular Weight: 307.32 g/mol
  • Sequence: γ-L-Glu-L-Cys-Gly
  • Synonyms: GSH, Reduced Glutathione
Peptide Sciences USA
  • Active Substance: Lipopeptide (Pal-Gly-Gln-Pro-Arg)
  • Concentration: 200 mg
  • Pack Size: Topical formulation (cream or serum)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: Lipopeptide
  • Molecular Formula: C38H68N6O8
  • Molecular Weight: 736.98 g/mol
  • Sequence: Pal-Gly-Gln-Pro-Arg
  • Synonyms: Pal-GQPR, Palmitoyl Tetrapeptide-7/3, Biopeptide EL
Peptide Sciences USA
  • Active Substance: Livagen (Lys-Glu-Asp-Ala)
  • Concentration: 20 mg per vial
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: Livagen
  • Molecular Formula: C18H31N5O9
  • Molecular Weight: 461.5 g/mol
  • Sequence: Lys-Glu-Asp-Ala
  • Synonyms: KEDA, Bioregulatory Tetrapeptide
Peptide Sciences USA
  • Active Substance: LL-37 (Cathelicidin)
  • Concentration: 5 mg per vial
  • Pack Size: Single vial (lyophilized powder)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: LL-37
  • Molecular Formula: C205H340N60O53
  • Molecular Weight: 4493.3 g/mol
  • Sequence: LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES
  • Synonyms: Cathelicidin, hCAP-18 (C-terminal)
Peptide Sciences USA
  • Active Substances: 5-amino-1MQ (50 mg/capsule), NMN (50 mg/capsule), JBSNF-000088 (5 mg/capsule)
  • Concentration: 105 mg per capsule
  • Pack Size: 60 capsules
  • Manufacturer: Peptide Sciences USA
  • Brand Name: Peptide Blend
  • Molecular Formulas: 5-amino-1MQ (C10H11N2), NMN (C11H15N2O8P), JBSNF-000088 (C7H8N2O)
  • Molecular Weights: 5-amino-1MQ (159.21 g/mol), NMN (334.22 g/mol), JBSNF-000088 (136.15 g/mol)
  • Synonyms: 5-amino-1-methylquinolinium, Nicotinamide Mononucleotide, 6-Methoxynicotinamide
Peptide Sciences USA
  • Product Title: Matrixyl 200 mg
  • Active Substance: Matrixyl (Palmitoyl Pentapeptide-4)
  • Concentration: 200 mg
  • Pack Size: Topical formulation (cream or serum)
  • Manufacturer: Peptide Sciences USA
  • Brand Name: Matrixyl
  • Molecular Formula: C39H75N7O10
  • Molecular Weight: 802.05 g/mol
  • Sequence: Pal-Lys-Thr-Thr-Lys-Ser-OH
  • Synonyms: Pal-KTTKS, Palmitoyl Pentapeptide-3, Micro-collagen
Showing 50 of 173 products