Home
Peptides By Research Purpose
Peptides By Research Purpose
Filters
Filters
Peptides By Research Purpose
Filter By Price
$
$
Brands
Substances
Manufacturers
Shipping Location
Default
Default
Price, low to high
Price, high to low
Pentapeptide-18 200 mg
- Active Substance: Pentapeptide-18 (Leuphasyl)
- Concentration: 200 mg per container
- Pack Size: Topical
- Manufacturer: Peptide Sciences USA
- Brand Name: Leuphasyl
- Molecular Formula: C29H39N5O7
- Molecular Weight: 569.65 g/mol
- Sequence: Tyr-D-Ala-Gly-Phe-Leu
- Synonyms: Leuphasyl, Pentapeptide Leucine
Out of Stock
Pinealon 20 mg
- Active Substance: Pinealon (Tripeptide Bioregulator)
- Concentration: 20 mg per vial
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: Pinealon
- Molecular Formula: C14H26N6O8
- Molecular Weight: 406.40 g/mol
- Sequence: Glu-Asp-Arg (EDR)
- Synonyms: EDR Peptide, Pinealon Tripeptide
Out of Stock
PNC-27 5 mg
- Active Substance: PNC-27 Anti-Cancer Peptide
- Concentration: 5 mg per vial
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: PNC-27
- Molecular Formula: C188H293N53O44S
- Molecular Weight: 4031.7 g/mol
- Sequence: PPLSQETFSDLWKLL-KKWKMRRNQFWVKVQRG
- Synonyms: PNC-27 Peptide, p53 12-26 Penetratin
Out of Stock
Prostamax 20 mg
- Active Substance: Prostamax (Khavinson Tetrapeptide)
- Concentration: 20 mg per vial
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: Khavinson
- Molecular Formula: C20H33N5O9
- Molecular Weight: 487.5 g/mol
- Sequence: Lys-Glu-Asp-Pro (KEDP)
- Synonyms: KEDP, Prostamax Bioregulator
Out of Stock
PT-141 10 mg
- Active Substance: Bremelanotide (PT-141)
- Concentration: 10 mg per vial
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: PT 141
- Molecular Formula: C50H68N14O10
- Molecular Weight: 1025.18 g/mol
- Sequence: Ac-Nle-cyclo[Asp-His-D-Phe-Arg-Trp-Lys]-OH
- Synonyms: PT-141, Vyleesi, Bremelanotide Acetate
Out of Stock
Repair and Recovery
- Active Substances: Thymosin Beta 4 Fragment (Ac-SDKP), Stable BPC-157 Arginate
- Concentration: 3 mg per capsule (250 mcg BPC-157 Arginate, 2.5 mg Ac-SDKP)
- Pack Size: 60 capsules
- Manufacturer: Peptide Sciences USA
- Brand Name: Peptide Blend
- Molecular Formula (BPC-157 Arginate): C62H98N16O22
- Molecular Weight (BPC-157 Arginate): 1419 g/mol
- Sequence (BPC-157 Arginate): Gly-Glu-Pro-Pro-Pro-Gly-Lys-Pro-Ala-Asp-Asp-Ala-Gly-Leu-Val
- Molecular Formula (Ac-SDKP): C20H33N5O9
- Molecular Weight (Ac-SDKP): 487.5 g/mol
- Sequence (Ac-SDKP): Ac-Ser-Asp-Lys-Pro
- Synonyms: BPC-157 Arginate, TB-4 Fragment, Ac-SDKP, Goralatide, Seraspenide
Out of Stock
Rigin 200 mg
- Active Substance: Palmitoyl Tetrapeptide-7 (Rigin™)
- Concentration: 200 mg per container
- Pack Size: Topical (powder for reconstitution)
- Manufacturer: Peptide Sciences USA
- Brand Name: Rigin
- Molecular Formula: C34H62N8O7
- Molecular Weight: 694.9 g/mol
- Sequence: Palmitoyl-Gly-Gln-Pro-Arg (Pal-GQPR)
- Synonyms: Rigin, Palmitoyl Tetrapeptide-3, Pal-GQPR
Out of Stock
Selank 30 mg
- Active Substance: Selank Anxiolytic Peptide
- Concentration: 30 mg per vial
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: Selank
- Molecular Formula: C33H57N11O9
- Molecular Weight: 751.9 g/mol
- Sequence: Thr-Lys-Pro-Arg-Pro-Gly-Pro (TKPRPGP)
- Synonyms: Selank, TP-7, Tuftsin Analog
Out of Stock
Selank 5 mg
Product Details
- Active Substance: Selank Anxiolytic Peptide
- Concentration: 5 mg per vial
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: Selank
- Molecular Formula: C33H57N11O9
- Molecular Weight: 751.9 g/mol
- Sequence: Thr-Lys-Pro-Arg-Pro-Gly-Pro (TKPRPGP)
- Synonyms: Selank, TP-7, Tuftsin Analog
Out of Stock
Semax 30 mg
- Active Substance: Semax Heptapeptide
- Concentration: 30 mg per vial
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: Semax
- Molecular Formula: C37H51N9O10S
- Molecular Weight: 813.92 g/mol
- Sequence: Met-Glu-His-Phe-Pro-Gly-Pro (MEHFPGP)
- Synonyms: Semax, ACTH(4-10) Analog, Pro-Gly-Pro-ACTH
Out of Stock
Semax 2 mg
- Active Substance: Semax Heptapeptide
- Concentration: 30 mg per vial
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: Semax
- Molecular Formula: C37H51N9O10S
- Molecular Weight: 813.92 g/mol
- Sequence: Met-Glu-His-Phe-Pro-Gly-Pro (MEHFPGP)
- Synonyms: Semax, ACTH(4-10) Analog, Pro-Gly-Pro-ACTH
Out of Stock
Semax 5 mg
- Active Substance: Semax Heptapeptide
- Concentration: 5 mg per vial
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: Semax
- Molecular Formula: C37H51N9O10S
- Molecular Weight: 813.92 g/mol
- Sequence: Met-Glu-His-Phe-Pro-Gly-Pro (MEHFPGP)
- Synonyms: Semax, ACTH(4-10) Analog, Pro-Gly-Pro-ACTH
Out of Stock
Sermorelin / GHRP-6 / GHRP-2 9 mg
- Active Substances: Sermorelin, GHRP-6, GHRP-2
- Concentration: 9 mg per vial (3 mg each peptide)
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: Peptide Blend
- Synonyms: Sermorelin Acetate, GHRP-6 Acetate, GHRP-2 Acetate, Growth Hormone Peptide Blend
Out of Stock
Sermorelin 10 mg
- Active Substance: Sermorelin (GHRH Analog)
- Concentration: 10 mg per vial
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: Sermorelin
- Molecular Formula: C149H246N44O42S
- Molecular Weight: 3357.88 g/mol
- Sequence: Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-NH2
- Synonyms: Sermorelin Acetate, GHRH (1-29)
Out of Stock
Sermorelin 2 mg
- Active Substance: Sermorelin (GHRH Analog)
- Concentration: 2 mg per vial
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: Sermorelin
- Molecular Formula: C149H246N44O42S
- Molecular Weight: 3357.88 g/mol
- Sequence: Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-NH2
- Synonyms: Sermorelin Acetate, GHRH (1-29)
Out of Stock
SLU-PP-332
- Active Substance: SLU-PP-332 (Pan-ERR Agonist)
- Concentration: 1000 mcg per capsule
- Pack Size: 30 capsules (30,000 mcg total)
- Manufacturer: Peptide Sciences USA
- Brand Name: SLU-PP-332
- Molecular Formula: Not fully disclosed (medium-length peptide)
- Molecular Weight: 290.32 g/mol
- Sequence: Proprietary (10–30 amino acids)
- Synonyms: SLU-PP-332, ERR Agonist, Exercise Mimetic
Out of Stock
SNAP-8 200 mg
- Active Substance: Acetyl Octapeptide-3 (SNAP-8)
- Concentration: 200 mg per container
- Pack Size: Topical (lyophilized powder for reconstitution)
- Manufacturer: Peptide Sciences USA
- Brand Name: SNAP-8
- Molecular Formula: C41H70N16O16S
- Molecular Weight: 1075.16 g/mol
- Sequence: Ac-Glu-Glu-Met-Gln-Arg-Arg-Ala-Asp-NH2
- Synonyms: SNAP-8, Acetyl Glutamyl Heptapeptide-1, Acetyl Octapeptide-3
Out of Stock
SS-31 25 mg
- Active Substance: SS-31 Mitochondria-Targeting Peptide (Elamipretide)
- Concentration: 25 mg per vial
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: Elamipretide
- Molecular Formula: C32H49N9O5
- Molecular Weight: 639.8 g/mol
- Sequence: D-Arg-2,6-dimethylTyr-Lys-Phe-NH2
- Synonyms: Elamipretide, Bendavia, MTP-131
Out of Stock
Syn-AKE 200 mg
- Active Substance: Dipeptide Diaminobutyroyl Benzylamide Diacetate (Syn-AKE)
- Concentration: 200 mg per container
- Pack Size: Topical
- Manufacturer: Peptide Sciences USA
- Brand Name: Syn-AKE
- Molecular Formula: C23H37N5O7
- Molecular Weight: 495.57 g/mol
- Sequence: β-Ala-Pro-Dab-NHBn
- Synonyms: Syn-AKE, Tripeptide-3, Syn-AKE Acetate
Out of Stock
Syn-Coll 200 mg
- Active Substance: Palmitoyl Tripeptide-5 (Syn-Coll)
- Concentration: 200 mg per container
- Pack Size: Topical (lyophilized powder for reconstitution)
- Manufacturer: Peptide Sciences USA
- Brand Name: Syn-Coll
- Molecular Formula: C33H65N5O5
- Molecular Weight: 611.9 g/mol
- Sequence: Pal-Lys-Val-Lys
- Synonyms: Syn-Coll, Tripeptide-5, Palmitoyl-Lys-Val-Lys
Out of Stock