Home
Peptides By Research Purpose
Peptides By Research Purpose
Filters
Filters
Peptides By Research Purpose
Filter By Price
$
$
Brands
Substances
Manufacturers
Shipping Location
Default
Default
Price, low to high
Price, high to low
Gonadorelin 10 mg
- Active Substance: Gonadotropin-Releasing Hormone (Gonadorelin)
- Concentration: 10 mg per vial
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: Gonadorelin
- Molecular Formula: C55H75N17O13
- Molecular Weight: 1182.29 g/mol
- Sequence: pGlu-His-Trp-Ser-Tyr-Gly-Leu-Arg-Pro-Gly-NH2
- Synonyms: GnRH, LHRH, Gonadotropin-Releasing Hormone
Out of Stock
Gut Inflammation
- Active Substances: Stable BPC-157 (Arginate Salt, 500 mcg), KPV (500 mcg), PEA (400 mg), Tributyrin (400 mg)
- Concentration: 801 mg per capsule
- Pack Size: 60 capsules
- Manufacturer: Peptide Sciences USA
- Brand Name: Peptide Blend
- Molecular Formulas: BPC-157 (C62H98N16O22), KPV (C16H30N4O4), PEA (C18H37NO2), Tributyrin (C15H26O6)
- Molecular Weights: BPC-157 (~1419 g/mol), KPV (342.43 g/mol), PEA (299.49 g/mol), Tributyrin (302.36 g/mol)
Out of Stock
Hexarelin 2 mg
- Active Substance: Hexarelin
- Concentration: 2 mg per vial
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: Hexarelin
- Molecular Formula: C47H58N12O6
- Molecular Weight: 887.04 g/mol
- Sequence: His-D-2-Me-Trp-Ala-Trp-D-Phe-Lys-NH2
- Synonyms: Growth Hormone Secretagogue, Examorelin
Out of Stock
Hexarelin 5 mg
- Active Substance: Hexarelin
- Concentration: 5 mg per vial
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: Hexarelin
- Molecular Formula: C47H58N12O6
- Molecular Weight: 887.04 g/mol
- Sequence: His-D-2-Me-Trp-Ala-Trp-D-Phe-Lys-NH2
- Synonyms: Growth Hormone Secretagogue, Examorelin
Out of Stock
hGH Fragment 176-191 6 mg
- Active Substance: Growth Hormone Peptide Fragment 176-191
- Concentration: 6 mg per vial
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: Fragment HGH
- Molecular Formula: C78H125N20O23S
- Molecular Weight: ~1817 g/mol
- Sequence: Tyr-Leu-Arg-Ile-Val-Gln-Cys-Arg-Ser-Val-Glu-Gly-Ser-Cys-Gly-Phe
- Synonyms: hGH Fragment, AOD9604
Out of Stock
Humanin 10 mg
- Active Substance: Humanin
- Concentration: 10 mg per vial
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: Humanin
- Molecular Formula: C119H204N34O32S
- Molecular Weight: ~2687 g/mol
- Sequence: Met-Ala-Pro-Arg-Gly-Phe-Ser-Cys-Leu-Leu-Leu-Leu-Thr-Ser-Glu-Ile-Asp-Leu-Pro-Val-Lys-Arg-Arg-Ala
- Synonyms: Mitochondrial-Derived Peptide, HN
Out of Stock
IGF-1 DES 1 mg
- Active Substance: Insulin-Like Growth Factor 1, DES
- Concentration: 1 mg per vial
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: IGF-1 DES
- Molecular Formula: C319H501N91O96S7
- Molecular Weight: ~7377 g/mol
- Sequence: TLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
- Synonyms: DES(1-3)IGF-1, Truncated IGF-1
Out of Stock
IGF-1-LR3 1 mg
- Active Substance: Insulin-like Growth Factor 1, Long R3
- Concentration: 1 mg per vial
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: IGF-1 LR3
- Molecular Formula: C400H625N111O115S9
- Molecular Weight: 9117.5 g/mol
- Sequence: MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
- Synonyms: Long R3 IGF-1, LR3-IGF-1
Out of Stock
Ipamorelin 10 mg
- Active Substance: Ipamorelin
- Concentration: 10 mg per vial
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: Ipamorelin
- Molecular Formula: C38H49N9O5
- Molecular Weight: 711.85 g/mol
- Sequence: Aib-His-D-2-Nal-D-Phe-Lys-NH2
- Synonyms: Growth Hormone Secretagogue, GHRP
Out of Stock
Ipamorelin 5 mg
- Active Substance: Ipamorelin
- Concentration: 5 mg per vial
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: Ipamorelin
- Molecular Formula: C38H49N9O5
- Molecular Weight: 711.85 g/mol
- Sequence: Aib-His-D-2-Nal-D-Phe-Lys-NH2
- Synonyms: Growth Hormone Secretagogue, GHRP
Out of Stock
Ipamorelin 2 mg
- Active Substance: Ipamorelin
- Concentration: 2 mg per vial
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: Ipamorelin
- Molecular Formula: C38H49N9O5
- Molecular Weight: 711.85 g/mol
- Sequence: Aib-His-D-2-Nal-D-Phe-Lys-NH2
- Synonyms: Growth Hormone Secretagogue, GHRP
Out of Stock
Kisspeptin-10 5 mg
- Active Substance: Metastin (Kisspeptin-10)
- Concentration: 5 mg per vial
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: Kisspeptin
- Molecular Formula: C63H83N17O14
- Molecular Weight: 1302.4 g/mol
- Sequence: Tyr-Asn-Trp-Asn-Ser-Phe-Gly-Leu-Arg-Phe-NH2
- Synonyms: Kp-10, Kisspeptin, Metastin
Out of Stock
KPV 5 mg
- Active Substance: Lysine-Proline-Valine (KPV)
- Concentration: 5 mg per vial
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: KPV
- Molecular Formula: C16H30N4O4
- Molecular Weight: 342.43 g/mol
- Sequence: Lys-Pro-Val
- Synonyms: α-MSH(11-13), Melanocortin Tripeptide
Out of Stock
L-Glutathione 600 mg
- Active Substance: Glutathione (L-Glutathione)
- Concentration: 600 mg per vial
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: Glutathione
- Molecular Formula: C10H17N3O6S
- Molecular Weight: 307.32 g/mol
- Sequence: γ-L-Glu-L-Cys-Gly
- Synonyms: GSH, Reduced Glutathione
Out of Stock
Lipopeptide 200 mg
- Active Substance: Lipopeptide (Pal-Gly-Gln-Pro-Arg)
- Concentration: 200 mg
- Pack Size: Topical formulation (cream or serum)
- Manufacturer: Peptide Sciences USA
- Brand Name: Lipopeptide
- Molecular Formula: C38H68N6O8
- Molecular Weight: 736.98 g/mol
- Sequence: Pal-Gly-Gln-Pro-Arg
- Synonyms: Pal-GQPR, Palmitoyl Tetrapeptide-7/3, Biopeptide EL
Out of Stock
Livagen 20 mg
- Active Substance: Livagen (Lys-Glu-Asp-Ala)
- Concentration: 20 mg per vial
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: Livagen
- Molecular Formula: C18H31N5O9
- Molecular Weight: 461.5 g/mol
- Sequence: Lys-Glu-Asp-Ala
- Synonyms: KEDA, Bioregulatory Tetrapeptide
Out of Stock
LL-37 5 mg
- Active Substance: LL-37 (Cathelicidin)
- Concentration: 5 mg per vial
- Pack Size: Single vial (lyophilized powder)
- Manufacturer: Peptide Sciences USA
- Brand Name: LL-37
- Molecular Formula: C205H340N60O53
- Molecular Weight: 4493.3 g/mol
- Sequence: [LL-37, 37 aa]
- Synonyms: Cathelicidin, hCAP-18 (C-terminal)
Out of Stock
Longevity - Performance & Obesity Research
- Active Substances: 5-amino-1MQ (50 mg/capsule), NMN (50 mg/capsule), JBSNF-000088 (5 mg/capsule)
- Concentration: 105 mg per capsule
- Pack Size: 60 capsules
- Manufacturer: Peptide Sciences USA
- Brand Name: Peptide Blend
- Molecular Formulas: 5-amino-1MQ (C10H11N2), NMN (C11H15N2O8P), JBSNF-000088 (C7H8N2O)
- Molecular Weights: 5-amino-1MQ (159.21 g/mol), NMN (334.22 g/mol), JBSNF-000088 (136.15 g/mol)
- Synonyms: 5-amino-1-methylquinolinium, Nicotinamide Mononucleotide, 6-Methoxynicotinamide
Out of Stock
Matrixyl 200 mg
- Product Title: Matrixyl 200 mg
- Active Substance: Matrixyl (Palmitoyl Pentapeptide-4)
- Concentration: 200 mg
- Pack Size: Topical formulation (cream or serum)
- Manufacturer: Peptide Sciences USA
- Brand Name: Matrixyl
- Molecular Formula: C39H75N7O10
- Molecular Weight: 802.05 g/mol
- Sequence: Pal-Lys-Thr-Thr-Lys-Ser-OH
- Synonyms: Pal-KTTKS, Palmitoyl Pentapeptide-3, Micro-collagen
Out of Stock
Melanostatin DM 200 mg
- Active Substance: Melanostatin DM (His-D-Arg-Ala-Trp-D-Phe-Lys)
- Concentration: 200 mg
- Pack Size: Topical formulation
- Manufacturer: Peptide Sciences USA
- Brand Name: Melanostatin DM
- Molecular Formula: C41H58N14O6
- Molecular Weight: 842.0 g/mol
- Sequence: His-D-Arg-Ala-Trp-D-Phe-Lys
- Synonyms: Melanostatine-5, Melanocyte-Inhibiting Peptide
Out of Stock
Out Of Stock
Out Of Stock
Out Of Stock
Out Of Stock
Out Of Stock
Out Of Stock
Out Of Stock
Out Of Stock
Out Of Stock
Out Of Stock
Out Of Stock
Out Of Stock
Out Of Stock
Out Of Stock
Out Of Stock
Out Of Stock
Out Of Stock
Out Of Stock
Out Of Stock
Out Of Stock